(data stored in ACNUC1104 zone)

EMBL: BX640427.PE83

BX640427.PE83        Location/Qualifiers
FT   CDS_pept        complement(80658..81950)
FT                   /transl_table=11
FT                   /locus_tag="BPP1374"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   transmembrane protein DctM SWALL:Q9F7C8 (EMBL:AF282677)
FT                   (416 aa) fasta scores: E(): 4.9e-61, 43.9% id in 410 aa,
FT                   and to Pasteurella multocida hypothetical protein Pm1527
FT                   SWALL:Q9CKS9 (EMBL:AE006189) (442 aa) fasta scores: E():
FT                   1.2e-58, 39.11% id in 427 aa"
FT                   /db_xref="GOA:Q7WAK2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK2"
FT                   /protein_id="CAE36676.1"
FT                   /translation="MIESLSALGAMLALVFMRVPVAFAMALVGFVGLGLLRGWPPAYAM
FT                   AGSVIYESGFQYLLSVLPLFILMGNFVTESRMSRELYAAAHALLGHRRGGLAMSTIAAC
FT                   GGFGAICGSSLATAATMAKVAYPEMRRMGYSEKLAAGSIAAGGTLGVLIPPSIIMVVYC
FT                   LLTEQSIGKMFAAGVLPGVLAILCYMAAVAWVVRRDPAAGPRGPRSTWPHTLHALRQVW
FT                   MVLALIGMLLGGIYGGLFTPAEAAGVGAFLSFLFACSRRAMTWRRFLDVVVESAKTTGM
FT                   IFVVMIGALMLANFINFTSLPQDLLDVVARHQLSPLTVILAICVIYIVLGCVLESMSMI
FT                   LLTVPVFYPLVQSLGFDLIWFGVIVVVVTEISFITPPFGMNVFVLRGLLPGVSTPTIFR
FT                   GVMPFVVSDVVRLAILVLFPSISLLLPSYVR"
     atgattgaat ccctatccgc cctgggcgcc atgctggcgc tggttttcat gcgcgtgccc        60
     gtggccttcg ccatggcgct ggtcggcttc gtcggcctgg gcctgctgcg cggctggccg       120
     cccgcctacg ccatggccgg ctcggtgatc tacgaaagcg gcttccagta cctgctgtcg       180
     gtgctgccgc tgttcatcct gatgggcaac ttcgtcaccg aatcgcgcat gtcgcgcgaa       240
     ctgtacgccg ccgcccacgc gctgctgggc caccggcgcg gcggcctggc gatgtccacc       300
     atcgccgcct gcggcggttt cggcgccatc tgcggctcca gcctggcgac ggccgcgacg       360
     atggccaagg tcgcctatcc ggaaatgcgc cgcatgggct acagcgagaa gctggcggcc       420
     ggttcgatcg ccgccggcgg cacgctgggc gtgctgattc ccccctccat catcatggtg       480
     gtgtattgcc tgctgaccga acagagcatc ggcaagatgt tcgccgccgg cgtgctgccc       540
     ggcgtgctgg cgatcctgtg ctacatggcg gcggtggcct gggtggtgcg ccgcgatccg       600
     gccgcggggc cgcgcggccc gcgcagcacc tggccgcata ccctgcacgc gctgcggcag       660
     gtctggatgg tgctggcgct gatcggcatg ctgctgggcg gcatctacgg cggcctgttc       720
     acgccggccg aggccgccgg cgtcggcgcc ttcctcagct tcctgttcgc ctgcagccgg       780
     cgcgccatga cgtggcgccg cttcctggac gtggtggtcg aatcggccaa gaccaccggc       840
     atgatcttcg tggtgatgat aggcgcgctg atgctggcca atttcatcaa cttcacctcg       900
     ctgccgcagg acttgctgga cgtggtcgcc cgccaccagc tcagcccgct gacggtgatc       960
     ctggccatct gcgtcatcta catcgtgctg ggctgcgtgc tggagagcat gtccatgatc      1020
     ctgctgacgg tgccggtgtt ctacccgctg gtgcagagcc tgggcttcga cctgatctgg      1080
     ttcggcgtca tcgtggtggt ggtcaccgag atcagcttca tcacgccgcc cttcggcatg      1140
     aatgtgttcg tgctgcgcgg actgctgccc ggcgtgtcca cgcccacgat cttccgcggc      1200
     gtcatgccgt tcgtggtcag cgacgtggtg cgcctggcga tcctggtgct gtttccctcg      1260
     atctcgctct tgctgccgtc gtacgtgcgc tag                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page