(data stored in ACNUC1104 zone)

EMBL: BX640427.PE84

BX640427.PE84        Location/Qualifiers
FT   CDS_pept        complement(81943..82434)
FT                   /transl_table=11
FT                   /locus_tag="BPP1375"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Rb0359 or Smb20373 SWALL:Q92WI0 (EMBL:AL603643) (155 aa)
FT                   fasta scores: E(): 0.0014, 24.34% id in 152 aa, and to
FT                   Escherichia coli hypothetical protein YiaM or B3577
FT                   SWALL:YIAM_ECOLI (SWALL:P37674) (157 aa) fasta scores: E():
FT                   0.0014, 25.8% id in 155 aa"
FT                   /db_xref="GOA:Q7WAK1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK1"
FT                   /protein_id="CAE36677.1"
FT                   /translation="MRILDRAVTALLRAIVVISLCGMSLLTVADATGRYLLNRPIMGTV
FT                   EMVELLMVAVIFASIPLVTRARGHITVDSFSHLFSPATLRAQDCVAGLLALTVSACLAW
FT                   VALRKAQSTADYGDMTPMLNIPLAPFVYAMAVLLALDAAYRLAALVGPAATQPEPTQDD
FT                   "
     atgcggatcc tggaccgggc cgtcacggcc ctgctgcgcg ccatcgtggt catcagcctg        60
     tgcggcatga gcctgctgac ggtggccgac gccaccggac gctacctgct caaccgtccc       120
     atcatgggca ccgtcgagat ggtcgagctg ctgatggtgg cggtgatctt cgccagcatc       180
     ccgctggtga cccgcgcgcg cggccacatc acggtcgaca gcttcagcca cctgttctcg       240
     cccgcgaccc tgcgcgcgca ggactgcgtg gccggcctgc tggcgctgac ggtcagcgcc       300
     tgcctggcct gggtggcgct gcgcaaggcg cagagcaccg ccgactacgg cgacatgacg       360
     cccatgctca acattcccct ggcacccttc gtatacgcca tggcggtact gctggccctg       420
     gacgccgcct accggctggc ggccctggtc gggcctgccg ctacgcagcc ggaaccgacc       480
     caagatgatt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page