(data stored in ACNUC1104 zone)

EMBL: BX640427.PE85

BX640427.PE85        Location/Qualifiers
FT   CDS_pept        complement(82444..83475)
FT                   /transl_table=11
FT                   /locus_tag="BPP1376"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   periplasmatic membrane protein DctP SWALL:Q9F7C9
FT                   (EMBL:AF282677) (330 aa) fasta scores: E(): 4.2e-20, 27.19%
FT                   id in 342 aa, and to Pasteurella multocida DctP or Pm1525
FT                   SWALL:Q9CKT1 (EMBL:AE006189) (340 aa) fasta scores: E():
FT                   4.5e-21, 28.78% id in 337 aa"
FT                   /db_xref="GOA:Q7WAK0"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK0"
FT                   /protein_id="CAE36678.1"
FT                   /translation="MMHKTLAAALFALGLAGTAPAIAQKPVELTLSSWLPPTHAVVADF
FT                   LMPWGEEIRKATDGRVTLRLLPKAVTNPAGHFDAVRDGLVDVTFVSHAYYPGRFQLTKF
FT                   AVLPFSGDTATSRSIAAWDTYEKYLLKADEHKGVRLLGIYAHGPGIAFTTSKPVKQIGD
FT                   FQGLKIRVGGGMAADVAKAVGASPIAKPAPESYELLSTGVADGVFFPAESLVSFKLDSI
FT                   IRHATEFPGGLYSDTHAVIINRDAFARLSKQDQDTLVRLSGRHLAELAGRAWDTHDAAA
FT                   RKVLEGGEIELVKADDALIEAVRERTKGFEQAWLDAAKAKGIDGPAALASFRAEIKQLD
FT                   QQR"
     atgatgcaca agaccctcgc cgccgccctg ttcgcccttg gccttgcggg cacggccccc        60
     gccatcgcgc aaaagccggt cgagctcacc ctgtcgagct ggctgccgcc cacccatgcg       120
     gtcgtggcgg acttcctcat gccctggggc gaggaaatcc gcaaggccac cgatggccgc       180
     gtgacgctgc gcctgctgcc caaggcggtc accaacccgg ccggccactt cgacgccgtg       240
     cgcgatggcc tggtcgacgt gaccttcgtc tcgcacgcct attaccccgg gcgcttccag       300
     ctgaccaagt tcgccgtgct gccgttctcc ggcgacaccg cgacctcgcg ctccatcgcg       360
     gcctgggaca cctacgagaa atacctgctc aaggccgacg agcacaaggg cgtgcgcctg       420
     ctgggcatct acgcgcacgg cccgggcatc gccttcacca ccagcaagcc ggtcaagcag       480
     atcggcgact tccagggcct gaagatccgc gtcggcggcg gcatggcggc cgacgtggcc       540
     aaggcggtgg gcgccagtcc catcgccaag ccggcgcccg agtcgtacga actgctcagc       600
     accggcgtgg ccgacggcgt gttcttcccg gccgaatcgc tggtgtcgtt caagctggac       660
     agcatcatca ggcacgccac cgaattcccc ggcggcctgt attcggacac gcacgcagtc       720
     atcatcaacc gcgacgcctt cgcgcgcctg tccaagcagg accaggacac gctggtgcgc       780
     ctgtcgggcc gccacctggc cgagctggcc ggacgcgcct gggacacgca cgacgcggcc       840
     gcgcgcaagg tgctcgaagg cggcgagatc gaactggtca aggccgacga cgcgctgatc       900
     gaggccgtgc gcgaacgcac caaggggttc gagcaggcat ggctggacgc ggccaaggcc       960
     aagggcatcg acgggcccgc cgcgctggcg tcgttccgcg ccgagatcaa gcagctggac      1020
     cagcaacgct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page