(data stored in ACNUC1104 zone)

EMBL: BX640427.PE86

BX640427.PE86        Location/Qualifiers
FT   CDS_pept        complement(83531..84490)
FT                   /transl_table=11
FT                   /locus_tag="BPP1377"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Alcaligenes eutrophus hypothetical 34.2
FT                   kDa protein in gbd 5'region SWALL:Q44016 (EMBL:L36817) (324
FT                   aa) fasta scores: E(): 6.5e-35, 41% id in 317 aa, and to
FT                   Yersinia pestis hypothetical protein Ypo2238 SWALL:Q8ZED6
FT                   (EMBL:AJ414151) (333 aa) fasta scores: E(): 1.9e-31, 35.64%
FT                   id in 317 aa"
FT                   /db_xref="GOA:Q7WAJ9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ9"
FT                   /protein_id="CAE36679.1"
FT                   /translation="MRVLITGANGYIGRALAERLCALPGVPGYGALEQLTLCDLAFDAA
FT                   PADPRVRQVAGDFADPATLAAITDPPPDLVFHLACVASGRAELEFELGLRVNLEGSLRL
FT                   LEQLRRQGRSPGLVFTSSIAVYGAPLPALVTDDTPLAPALSYGAQKQAVEILLADYTRR
FT                   GFVRGRAVRLPGVAPRPPAPNGAWSAFSSTLLRALAAGQPCEMPVGPQATLWLMSLPCC
FT                   VDNLLRAAELTAQAPPPGGRTGWTLPALRVSVRDIVQAFDARSQGAATPLVSYTPRPDI
FT                   EAQFGNQPPLQCDAAQAAGFRHDSSLPALLERAVGPPP"
     atgcgcgtcc tgatcaccgg cgccaacggc tatatcggcc gcgccctggc cgagcgcctg        60
     tgcgccctgc ccggcgtgcc cggctatggc gcgctcgaac agctgacgct gtgcgacctg       120
     gccttcgacg ccgcgccggc cgacccgcgc gtgcgccagg tggccggcga cttcgccgac       180
     cccgccacgc tggcggccat caccgatccg ccgccggacc tggtgttcca tctggcctgc       240
     gtcgccagcg gacgcgccga gctggagttc gagctgggcc tgcgcgtcaa cctggaagga       300
     tcgctgcgat tgctggagca gctgcgccgc cagggccgct cgcccggact ggtgttcacc       360
     agcagcatcg ccgtctacgg cgcgccgctg cccgcgctcg tcacggacga cacgccgctg       420
     gcgccggcgc tgagctatgg cgcgcagaag caggcagtcg aaatcctgtt ggccgactac       480
     acccggcgcg gcttcgtgcg cgggcgcgcc gtgcgcctgc ccggcgtggc gccccgcccg       540
     ccggcgccca acggcgcctg gtcggccttc tccagcacgc tgctgcgcgc gctggcggcg       600
     ggccagcctt gcgaaatgcc ggtcggcccg caggccacgc tgtggctgat gtcgctgccg       660
     tgctgcgtgg acaacctgct gcgcgccgcc gagctgaccg cccaggcgcc gccgcccggc       720
     gggcgcaccg gctggacgct gccggcgcta cgcgtgtcgg tgcgcgacat cgtgcaggcc       780
     ttcgatgcgc gcagccaggg cgcggccacg ccgttggtaa gttacacgcc gcgcccggat       840
     atcgaggcgc agttcggcaa ccagccgccc ctgcaatgcg atgccgcgca ggcggcgggc       900
     tttcgccacg acagcagcct gccggcgctg ctggagcggg ccgtcggccc gccgccttga       960
//

If you have problems or comments...

PBIL Back to PBIL home page