(data stored in ACNUC1104 zone)

EMBL: BX640427.PE88

BX640427.PE88        Location/Qualifiers
FT   CDS_pept        complement(85281..86177)
FT                   /transl_table=11
FT                   /locus_tag="BPP1379"
FT                   /product="probable dehydrogenase"
FT                   /note="Similar to Escherichia coli
FT                   2-hydroxy-3-oxopropionate reductase GarR or B3125
FT                   SWALL:GARR_ECOLI (SWALL:P23523) (294 aa) fasta scores: E():
FT                   6.9e-20, 33.21% id in 277 aa, and to Pseudomonas aeruginosa
FT                   probable 3-hydroxyisobutyrate dehydrogenase Pa3312
FT                   SWALL:Q9HYT2 (EMBL:AE004753) (296 aa) fasta scores: E():
FT                   8.3e-38, 47.97% id in 296 aa"
FT                   /db_xref="GOA:Q7WAJ7"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ7"
FT                   /protein_id="CAE36681.1"
FT                   /translation="MSATLAFCGAGLMGAPMIRRLLAAGHRVRVWNRSAAKAQALAADG
FT                   AVVCATPAEAAAGAQAVLLCLTDLAAVQATVFGPHGVADVAGGLLVDHSSIEPDATRAL
FT                   AARLLAASGRVWIDAPVSGGVAGAQAGTLSILAGGPAAAIEAAQPWLRAYAGRVTRLGD
FT                   TGAGQIGKLCNQTIVATTVNAIAEAVALARRNGIDVAALDTALAGGWADSVLLRIFVPR
FT                   MTAPVDQPLGALQTMLKNLENVAALAAASGTQLRGLQGVLDSYRTAAARGLGPGDLSDI
FT                   VRVAWPERPAAPTREPA"
     atgagcgcca ccctggcttt ctgcggcgcc ggcctgatgg gcgcgccgat gatacggcgg        60
     ctgctggcgg ccggccatcg ggtgcgcgta tggaaccgca gcgcggccaa ggcacaggcg       120
     ctggcggccg acggcgcggt ggtctgcgcc acgccggccg aagcggcggc gggcgcgcag       180
     gcggtgttgc tgtgcctgac cgacctggcc gcggtgcagg ccacggtgtt cgggccgcac       240
     ggcgtggccg acgtggccgg cggcctgctg gtggaccact ccagcatcga gccggacgcc       300
     acccgcgcgc tggccgcgcg cctgctggcc gccagcggcc gcgtatggat cgacgcgccg       360
     gtctcgggcg gcgtggccgg cgcgcaggcc ggcacgctgt ccatcctggc gggcgggccg       420
     gccgcggcga tcgaggccgc gcaaccctgg ctgcgcgcct acgccggccg cgtgacgcgg       480
     ctgggcgata cgggcgccgg ccagatcggc aagctgtgca accagaccat cgtggccacc       540
     acggtcaacg ccatcgccga ggccgtggcc ctggcccgcc gcaacggcat cgacgtcgcc       600
     gccctcgata ccgccctggc cggcggctgg gccgattcgg tcttgctgcg catcttcgtg       660
     ccgcgcatga ccgcgcccgt cgaccagccg ctgggcgccc tgcagaccat gctgaaaaac       720
     ctggagaacg tggccgccct ggccgccgcc agcggcacgc aactgcgcgg gctgcaaggc       780
     gtgctcgaca gctaccgcac cgccgccgcg cgcggcctgg gccccggcga cctgtccgac       840
     atcgtgcgcg tggcgtggcc cgaacggccc gccgcgccca ccagggagcc cgcatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page