(data stored in ACNUC1104 zone)

EMBL: BX640427.PE90

BX640427.PE90        Location/Qualifiers
FT   CDS_pept        complement(87927..88607)
FT                   /transl_table=11
FT                   /locus_tag="BPP1381"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti probable transcriptional
FT                   regulator Mlr1038 SWALL:Q98LF9 (EMBL:AP002996) (226 aa)
FT                   fasta scores: E(): 3.8e-22, 39.62% id in 212 aa, and to
FT                   Pseudomonas aeruginosa probable transcriptional regulator
FT                   Pa5525 SWALL:Q9HT48 (EMBL:AE004965) (246 aa) fasta scores:
FT                   E(): 3.7e-17, 35.18% id in 216 aa"
FT                   /db_xref="GOA:Q7WAJ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ5"
FT                   /protein_id="CAE36683.1"
FT                   /translation="MPALTHPDPLVHTSVNEAIYRRLRDHLMRGDYAAGAVLGIQELAD
FT                   AFGTSAMPVREALRRLVTQRALEPMKSRSVRVPVISRASLEDIRRARVLIEGHVTAWAV
FT                   EHITAPELAELRALADQIGRSLSDTASVQAGLENNQRFHFTIYRAARSDSMLATIESLW
FT                   LQSGPYLRATRELMHSDERPSAELHAAIVDAIARRDAESARAVMAQDISWAFDRLQALQ
FT                   PAMP"
     atgcctgcgc tcacccaccc cgatccgctc gtccatacct ccgtcaacga agccatctac        60
     cgccgcctgc gcgaccacct gatgcgcggc gactacgccg ccggcgcggt gctcggcatc       120
     caggaactgg ccgatgcgtt cggcaccagc gccatgccgg tgcgcgaggc gctgcgccgg       180
     ctggtcacgc agcgcgcgct cgaaccgatg aagagccgct cggtgcgcgt gccggtgatc       240
     tcgcgcgcca gcctggagga catccgccgc gcccgcgtgc tgatcgaggg ccatgtcacc       300
     gcctgggcgg tcgagcacat caccgcgccg gaactggccg agctgcgcgc gctggccgac       360
     cagatcggca ggtcgctcag cgatacggcg tcggtccagg ccgggctgga gaacaaccag       420
     cgctttcact tcaccattta ccgcgccgcg cgctcggact cgatgctggc caccatcgaa       480
     agcctgtggc tgcagtccgg gccctacctg cgcgccacgc gcgagctgat gcattccgac       540
     gagcgcccct cggccgaact gcacgccgcc atcgtcgacg ccatcgcgcg gcgcgacgcc       600
     gaaagcgcgc gcgcggtcat ggcgcaggac atcagctggg ccttcgacag gctgcaggcg       660
     ctgcagcccg ccatgcccta g                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page