(data stored in ACNUC1104 zone)

EMBL: BX640427.PE91

BX640427.PE91        Location/Qualifiers
FT   CDS_pept        complement(88704..89390)
FT                   /transl_table=11
FT                   /locus_tag="BPP1382"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti probable transcriptional
FT                   regulator Mlr2114 SWALL:Q98J42 (EMBL:AP002999) (223 aa)
FT                   fasta scores: E(): 2.2e-26, 45.45% id in 198 aa, and to
FT                   Agrobacterium rhizogenes Riorf32 protein SWALL:Q9F5G0
FT                   (EMBL:AP002086) (217 aa) fasta scores: E(): 2.6e-12, 32.99%
FT                   id in 197 aa"
FT                   /db_xref="GOA:Q7WAJ4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ4"
FT                   /protein_id="CAE36684.1"
FT                   /translation="MTLTALPADPPPADALDLDLAVEQLEEDIVFGRLFPRQRLTEDEL
FT                   MARFGLKRHAVRQVLAQLEQRGAVERKRNVGAEVRAFTAREVMDLYDLRELLETRAAER
FT                   IALPVDEARLAALVAVQREHDAAVAAGNARRVFRSNQRFHRELFGLLDNPVLQQAIEEY
FT                   ARRTHPIRFGSLAAAGYRERARQEHWAMIQALRQGDRAALVALCRNHLLPSRDAYLAAA
FT                   GLRASA"
     atgaccctga ccgccctgcc cgccgacccg ccgcccgccg acgccctgga cctggacctg        60
     gcggtggaac agctggaaga agacatcgtc ttcggccggc tgtttccgcg ccagcgcctg       120
     accgaggacg aactgatggc gcgcttcggg ctgaagcggc acgcggtgcg ccaggtgctg       180
     gcgcagctgg aacagcgcgg cgcggtcgag cgcaagcgca acgtgggcgc cgaagtgcgc       240
     gccttcacgg cgcgcgaagt catggacctg tacgacctgc gcgaactgct ggagacgcgc       300
     gcggccgagc gcatcgccct gcccgtggac gaggcgcgcc tggccgcgct ggtggccgtg       360
     cagcgcgagc acgacgccgc ggtggccgca ggcaacgcgc ggcgcgtgtt ccgcagcaac       420
     cagcggtttc accgcgaatt gttcggcctg ctcgacaacc cggtgctgca acaggccatc       480
     gaggaatacg cgcgccgcac ccacccgatc cgcttcggca gcctggccgc ggccggctac       540
     cgcgagcgcg cacgccagga acactgggcc atgatccagg cgctgcgcca gggcgaccgc       600
     gccgccctgg tggccctgtg ccgcaaccat ctgctgcctt cgcgcgacgc ctatctggcc       660
     gccgccggac tgcgcgccag cgcctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page