(data stored in ACNUC1104 zone)

EMBL: BX640427.PE92

BX640427.PE92        Location/Qualifiers
FT   CDS_pept        complement(89397..91139)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BPP1383"
FT                   /product="putative dihydroxy-acid dehydratase"
FT                   /note="Similar to Agrobacterium tumefaciens dihydroxy-acid
FT                   dehydratase IlvD or Atu3971 or Agr_l_1769 SWALL:AAL44773
FT                   (EMBL:AE009327) (574 aa) fasta scores: E(): 1.3e-95, 47.92%
FT                   id in 553 aa, and to Rhizobium meliloti putative
FT                   dihydroxy-acid dehydratase protein IlvD1 or R00822 or
FT                   Smc00884 SWALL:Q92RP0 (EMBL:AL591785) (574 aa) fasta
FT                   scores: E(): 4.5e-92, 49.09% id in 550 aa"
FT                   /db_xref="GOA:Q7WAJ3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ3"
FT                   /protein_id="CAE36685.1"
FT                   /translation="MTQRDQGGKPPGGLSKGLTNYGDTGFSLFLRKAFIKGAGYTDDAL
FT                   ARPVIGIVNTGSSYNPCHGNAPQLVEAVKRGVMLAGGLPVDFPTISVHESFSQPTSMYL
FT                   RNLMSMDTEEMIRAQPMDAVVLIGGCDKTVPAQLMGAASAGVPAIQLVTGSMLTGSHRG
FT                   ERVGACTDCRRYWGRYRADEIDTAEITDVNNQLVASVGTCSVMGTASTMACLTEALGMM
FT                   ISGGASAPAVTADRIRVAERTGATAVAMAAARLTPERILTGKAIENALRVLLAIGGSTN
FT                   GIVHLTAIAGRLGIDIDLTGLDRMSRETPVLVDLKPSGQHYMEDFHKAGGMPALLRELR
FT                   PLLHLDALTVSGRTLGEELDAAPAPFAQEVIRAFDAPIYPVGGLAVLRGNLAPGGAIIK
FT                   QSAADARLMEHEGRAVVFEDAEDMARRIDDDALDVTADDILVLKRIGPTGAPGMPEAGY
FT                   MPIPRKLARAGVKDMVRVSDGRMSGTAAGTIVLHVTPEAAIGGPLAHVRNGDRIRLSVR
FT                   QREISLLVSEAELAQRAAAQPIERPQAERGYRKLFLDTVTQADQGVDFDFLRAPASKQT
FT                   VPPR"
     atgacccagc gcgaccaagg cggcaagccg cccggcggcc tgtccaaggg cctgaccaac        60
     tacggcgaca ccggcttttc gctgttcctg cgcaaggcct tcatcaaggg cgcgggctat       120
     accgacgacg cgctggcgcg cccggtcatc ggcatcgtca acaccggcag cagctacaac       180
     ccctgccacg gcaacgcccc gcagctggtc gaggcggtca agcgcggcgt gatgctggcc       240
     ggcgggctgc cggtggactt tcccaccatc tcggtgcacg agagcttctc gcagcccacc       300
     agcatgtacc tgcgcaacct gatgtcgatg gacaccgaag agatgatccg cgcccagccc       360
     atggacgcgg tggtgctgat cggcggctgc gacaagacgg tgcccgcgca gctgatgggc       420
     gcggcctcgg ccggcgtgcc ggccatccag ctggtgaccg gctcgatgct gaccggctcg       480
     caccgcggcg aacgggtcgg cgcctgtacc gattgccgcc gctactgggg ccgctaccgc       540
     gccgacgaaa tcgacaccgc cgagatcacc gacgtcaaca accagctggt ggccagcgtg       600
     ggcacctgct cggtgatggg caccgccagc accatggcgt gcctgaccga ggcgctgggc       660
     atgatgatca gcggcggcgc ctcggcgccc gcggtcacgg ccgaccgcat ccgcgtggcc       720
     gaacgcaccg gcgccaccgc cgtggccatg gccgcggcgc gcctgacgcc cgagcgcatc       780
     ctgaccggca aggccatcga gaacgcgttg cgcgtgctgc tggccatcgg cggctcgacc       840
     aacggcatcg tgcacctgac ggccatcgcc ggccgcctgg gcatcgacat cgacctgacc       900
     ggcctggacc gcatgagccg cgagacaccg gtactggtgg atctcaagcc ctcgggccag       960
     cactacatgg aagacttcca caaggccggc ggcatgccgg cgctgctgcg cgaactgcgc      1020
     ccgctgctgc acctggacgc cctcaccgtc tcgggccgca cgctgggcga agagctcgac      1080
     gccgcgcccg cgccgttcgc gcaggaggtg atccgcgcct tcgacgcccc gatctacccg      1140
     gtgggcgggc tggcggtgct acgcggcaac ctggcgccgg gcggcgccat catcaagcag      1200
     tcggccgccg acgcccggct gatggagcac gaaggccgcg ccgtggtgtt cgaggacgcc      1260
     gaagacatgg cgcgccgcat cgacgacgac gcgctcgatg tcacggccga cgacatcctg      1320
     gtgctcaagc gcatcggccc caccggcgcg cccggcatgc ccgaggcggg ctacatgccc      1380
     attccgcgca agctggcgcg cgccggcgtc aaggacatgg tgcgcgtatc cgacggccgc      1440
     atgagcggca ccgccgccgg caccatcgtg ctgcacgtca cgcccgaggc cgccatcggc      1500
     ggaccgctgg cccacgtgcg caatggcgac cgcatccgcc tgtcggtgcg ccagcgcgag      1560
     atcagcctgc tggtcagcga ggccgagctg gcgcagcgcg cggccgccca gccgatcgaa      1620
     cggccgcagg ccgagcgggg ctaccgcaag ctgttcctcg acacggtcac gcaggccgac      1680
     cagggggtag acttcgactt cctgcgcgca cccgccagca agcaaaccgt gccgcctcgc      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page