(data stored in ACNUC1104 zone)

EMBL: BX640427.PE93

BX640427.PE93        Location/Qualifiers
FT   CDS_pept        91372..92376
FT                   /transl_table=11
FT                   /locus_tag="BPP1384"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   1.7e-46, 45.12% id in 328 aa, and to Rhizobium meliloti
FT                   hypothetical protein Ra1058 ra1058 or sma1927 SWALL:Q92Y30
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 2.1e-52, 45.87%
FT                   id in 327 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ2"
FT                   /protein_id="CAE36686.1"
FT                   /translation="MSDRQSARLPRRAALCSMLALCAGFALQPVAAQSAYPDRPIRMIV
FT                   PYPPGGATDVIGRVLAKEMSGALGQSVVVENRAGAAGNIGADVVAKATPDGYTILMGAM
FT                   TSHAINAVLYQGRVSYDIEKSFAPVAIVGTVPLVFVVNPAVPADSLQSLIALAKSKPGY
FT                   LTMASAGNGSPQHLAGEMFKRVAGVDLLHVPYKGSGPAMTDLMGGQVLSMIETVPAAQG
FT                   NVKGGKLRALAVASAQRVESLPDVPTTAEAGLPNFQVSSMFGIAAPAGTPVPVVERLNA
FT                   VLKEALAKPEVQTALLNQGAISTWTTPADAAARISAERQQWATVIAEAGVKAE"
     atgtccgacc gtcaatccgc gcgcctgccg cgccgcgccg ccctctgttc catgctggcg        60
     ctgtgcgccg gtttcgcgct gcagcccgtc gccgcgcaga gcgcctaccc cgaccgtccg       120
     atccgcatga tcgtgccgta ccccccgggc ggcgccacgg acgtgatcgg ccgcgtgctg       180
     gccaaggaaa tgagcggtgc gctgggccag tcggtggtgg tcgagaaccg cgccggcgcg       240
     gccggcaaca tcggcgccga cgtggtggcc aaggccacgc cggatggcta caccatcctg       300
     atgggcgcca tgaccagcca cgccatcaac gccgtgctct accagggccg cgtgtcgtac       360
     gacatcgaga agagtttcgc gcccgtggcc atcgtgggca cggtgccgct ggtgttcgtg       420
     gtcaatcccg ccgtgccggc cgattcgctg caaagcctga tcgcgctggc caagtccaag       480
     cccggctacc tgaccatggc gtcggccggc aacggttcgc cgcagcacct ggccggcgaa       540
     atgttcaagc gcgtggcggg cgtggacctg ctgcacgtgc cgtacaaggg cagcggcccg       600
     gccatgaccg acctgatggg cggccaggtg ctcagcatga tcgagaccgt gccggcggcg       660
     cagggcaacg tcaagggcgg caagctgcgc gcgctggcgg tggcctcggc gcagcgcgtc       720
     gaatcgctgc ccgacgtgcc gaccacggcc gaggccggcc tgcccaattt ccaggtcagt       780
     tcgatgttcg gcatcgccgc gccggccggc acgccggtcc cggtggtcga gcgcctgaac       840
     gccgtgctca aggaagcgct ggccaagccc gaggtgcaga ccgccttgct gaaccagggc       900
     gccatctcga cctggaccac gcctgccgac gccgccgcgc gcatcagcgc cgagcgccag       960
     cagtgggcca ccgtgatcgc cgaagccggc gtgaaggccg agtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page