(data stored in ACNUC1104 zone)

EMBL: BX640427.PE96

BX640427.PE96        Location/Qualifiers
FT   CDS_pept        complement(95076..95897)
FT                   /transl_table=11
FT                   /locus_tag="BPP1387"
FT                   /product="ATP-binding component of ABC transporter"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ABC-transport protein, ATP-binding component Sc8g12.21
FT                   SWALL:Q9KYY4 (EMBL:AL355753) (270 aa) fasta scores: E():
FT                   2.8e-40, 46.79% id in 265 aa, and to Agrobacterium
FT                   tumefaciens ABC transporter, nucleotide binding/ATPase
FT                   protein Atu0159 or Agr_c_259 SWALL:AAK85980 (EMBL:AE008990)
FT                   (266 aa) fasta scores: E(): 7.9e-40, 46.56% id in 262 aa"
FT                   /db_xref="GOA:Q7WAJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ0"
FT                   /protein_id="CAE36689.1"
FT                   /translation="MSATPASDVRIRFEDVCVDYPTADGPMRVLDGINYEIRQGEFVSV
FT                   IGPSGCGKTTMMGLVGGFVQPTAGRVLLDGQPVGGPGPDRGVIFQEYGVFPWLTVRENI
FT                   AFGLNLRSNRVAAGERAQICQRYMTLMGLSDFAHHYPKHLSGGMRQRLALARAYAVKPQ
FT                   FLLMDEPFGALDAQTRSAMQDLLLQVQMTEGKTVMLITHSVEEAIYLSSRIVVVTARPA
FT                   RIRTIIDVPFGYPRAENLHEDPRFGELRSHIRALVMEEYAKQARQTVRLSD"
     atgagcgcga ctcccgcctc cgacgtgcgc atccgcttcg aggatgtctg cgtggactac        60
     ccgaccgccg acggtccgat gcgcgtgctc gacggcatca attacgaaat ccgccagggc       120
     gagttcgtct cggtgatcgg cccctcgggc tgcggcaaga ccaccatgat gggactggtg       180
     ggcggcttcg tgcagcccac cgccggccgc gtgctgctcg acggccagcc ggtcggcggg       240
     cccgggcccg accgtggcgt gatcttccag gaatacggcg tgttcccgtg gctgacggtg       300
     cgcgagaaca tcgccttcgg cctgaacctg cgcagcaacc gcgtggcggc cggcgaacgg       360
     gcgcagatct gccagcgcta catgaccctg atgggcctga gcgacttcgc ccaccactat       420
     cccaagcacc tgtccggcgg catgcgccag cgcctggcgc tggcgcgcgc ctatgcggtc       480
     aagccgcagt tcctgctgat ggacgagccg ttcggcgcgc tcgacgcgca aacccgctcg       540
     gccatgcagg acctgctgct gcaggtgcag atgaccgagg gcaagaccgt catgctgatc       600
     acgcattcgg tcgaggaagc catctacctg tcgtcgcgca tcgtggtggt caccgcgcgg       660
     ccggcgcgca tccgcaccat catcgacgtg ccgttcggct acccccgggc cgagaacctg       720
     cacgaggacc cgcgctttgg cgagctgcgc tcgcacatcc gcgcgctggt catggaagag       780
     tatgccaagc aggcgcgcca gaccgtgcgc ctgtccgatt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page