(data stored in ACNUC1104 zone)

EMBL: BX640427.PE97

BX640427.PE97        Location/Qualifiers
FT   CDS_pept        complement(95917..96684)
FT                   /transl_table=11
FT                   /locus_tag="BPP1388"
FT                   /product="permease component of ABC transporter"
FT                   /note="Similar to Escherichia coli taurine transport system
FT                   permease protein TauC or SsiC or B0367 SWALL:TAUC_ECOLI
FT                   (SWALL:Q47539) (275 aa) fasta scores: E(): 6.8e-30, 34.48%
FT                   id in 261 aa, and to Brucella melitensis taurine transport
FT                   system permease protein tauc bmeii0107 SWALL:Q8YDR8
FT                   (EMBL:AE009649) (246 aa) fasta scores: E(): 4e-36, 46.05%
FT                   id in 228 aa"
FT                   /db_xref="GOA:Q7WAI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI9"
FT                   /protein_id="CAE36690.1"
FT                   /translation="MKRRSALMRALLVLAPWLLIVLLWYGIRASGLVSPALVPSPGEVW
FT                   TRFVALMQARLPHDILMSTQRVFVGVCLGTLLAVPVGFVLGWYRGVRSFIDPVINFFRA
FT                   LPPIALIPLVIVYFGIGETAKIAILFYASFFAGVIVMYEGISQINPIFVRVAKTLGATD
FT                   GEIFRKVIVPLTIPHMLTALRVALGVAWATLVASELIAAQQGLGALIQDASSFFQLDII
FT                   YVGIICIGFIALAMDLALRAAARRLVAWQDRIA"
     gtgaagcgtc gatccgcgct catgcgtgcg ctgctggtcc tggccccgtg gttgttgatc        60
     gtgctgctct ggtacggcat acgcgccagc gggctggtca gcccggccct ggtgcccagc       120
     cccggcgaag tctggacgcg gttcgtggcc ctgatgcagg cgcgcctgcc gcacgacatc       180
     ctcatgtcca cccagcgcgt gttcgtgggc gtctgcctgg gcaccctgct ggcggtgccg       240
     gtgggcttcg tgctgggctg gtaccgcggc gtgcgcagct tcatcgatcc ggtcatcaac       300
     ttcttccgcg ccctgccccc catcgcgctg atcccgctgg tcatcgtgta tttcggcatc       360
     ggcgagacgg ccaagatcgc catcctgttc tacgcctcgt tcttcgccgg cgtcatcgtc       420
     atgtacgagg gcatctcgca gatcaacccg atcttcgtgc gcgtggccaa gacgctgggc       480
     gcgaccgacg gcgagatctt ccgcaaggtc atcgtgccgc tgaccatccc gcacatgctg       540
     accgcgctgc gcgtggcgct gggcgtggcc tgggccacgc tggtggcctc ggaactgatc       600
     gcggcgcaac aggggctggg cgcgctgatc caggacgcct cctcgttctt ccagctcgac       660
     atcatctatg tcggcatcat ctgcatcggc ttcatcgccc tggccatgga cctcgccctg       720
     cgcgcggccg cgcgccggct ggtggcctgg caggaccgca tcgcctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page