(data stored in ACNUC1104 zone)

EMBL: BX640427.PE99

BX640427.PE99        Location/Qualifiers
FT   CDS_pept        97517..98665
FT                   /transl_table=11
FT                   /locus_tag="BPP1390"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme"
FT                   /note="Similar to Streptomyces coelicolor putative racemase
FT                   Sce65.16C SWALL:Q9RKF7 (EMBL:AL133236) (361 aa) fasta
FT                   scores: E(): 4e-21, 32.43% id in 370 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein Atu3139 or
FT                   Agr_l_3340 SWALL:AAL43955 (EMBL:AE009244) (378 aa) fasta
FT                   scores: E(): 6.4e-26, 32.36% id in 377 aa"
FT                   /db_xref="GOA:Q7WAI7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI7"
FT                   /protein_id="CAE36692.1"
FT                   /translation="MTRDAAPITPARVRAHVFRYPVSTPVKTSFGTMHDRPAVLVEVED
FT                   SDGAVGWGEVWCNFPACGAEHRARLVETVLAPLLTARAFADPAQAFAHLEARTAVLAIQ
FT                   TGEPGPLAQAIAGLDIALCDLAARRAGEPLWAWLGGSGDRIGVYASGINPENPEDVVAR
FT                   KAAEGYRAFKLKVGFDDARDVRNALHVRELLGAATPLMADANQGWDLPRARQMAQRLGP
FT                   AQLDWLEEPLRADRPAAEWAELAQAAPMPLAGGENIAGVAAFETALAARSLRVMQPDLA
FT                   KWGGFSGCLPVARAVVAAGLRYCPHYLGAGIGLQASAHLLAAVPGLASPGLLEVDANDN
FT                   PLRSLLSPALATLHEGRITLGGAPGLGVTPDLAALRAACAAR"
     atgacacgcg atgccgctcc gatcacgccc gcgcgggtgc gcgcgcatgt gttccgctat        60
     ccggtcagca cgccggtcaa gacctcgttc ggcaccatgc acgaccggcc ggcggtattg       120
     gtcgaggtcg aggacagcga tggcgcggtg ggctggggcg aggtctggtg caacttcccg       180
     gcctgcggcg ccgaacaccg cgcccgcctg gtcgagaccg tgctggcgcc gctgctgacc       240
     gcgcgcgcgt tcgccgatcc ggcgcaggcc ttcgcccatc tcgaggcgcg caccgcggtg       300
     ctggccatcc agaccggcga gcccggcccg ctggcccagg ccatcgcggg cctggacatc       360
     gcgctgtgcg acctggccgc gcggcgcgcc ggcgagccgc tgtgggcctg gctgggcggc       420
     agcggcgatc gcatcggcgt gtacgccagc ggcatcaacc ccgaaaatcc cgaggacgtc       480
     gtggcgcgca aggcggccga aggctaccgc gccttcaagc tgaaggtggg cttcgacgat       540
     gcgcgcgacg tccgcaatgc cctgcatgtg cgcgaactgc tgggcgcggc cacgccgctg       600
     atggccgacg ccaaccaggg ctgggacctg ccgcgcgcgc gccagatggc gcagcgcctg       660
     gggccggcgc agctggactg gctggaagag ccgctgcgcg ccgaccgtcc ggccgccgag       720
     tgggccgagc tggcccaggc cgcgcccatg ccgctggccg gcggcgagaa catcgccggc       780
     gtggcggcgt tcgagacggc gctggccgcg cgcagcctgc gcgtgatgca gcccgacctg       840
     gccaagtggg gcggtttcag cggctgcctg ccggtggcgc gcgccgtggt cgccgccggc       900
     ctgcgctatt gtccgcatta cctgggcgcc ggcatcggcc tgcaggcgtc ggcgcatctg       960
     ctggcggccg tgccgggcct ggccagtccc ggcctgctcg aagtcgacgc caacgacaac      1020
     cccttgcgca gcctgcttag tccggcgctg gcgaccctgc acgaaggccg catcacgctg      1080
     ggcggcgcgc ccgggctggg cgttacgccc gacctggcgg ccctgcgcgc cgcctgcgcc      1140
     gctcgctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page