(data stored in ACNUC1104 zone)

EMBL: BX640427.PPHA

BX640427.PPHA        Location/Qualifiers
FT   CDS_pept        343549..344283
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /gene_synonym="prpA"
FT                   /locus_tag="BPP1630"
FT                   /product="serine/threonine protein phosphatase 1"
FT                   /EC_number="3.1.3.16"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0904"
FT                   /db_xref="GOA:Q7W9W9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9W9"
FT                   /protein_id="CAE36931.1"
FT                   /translation="MAPNLQYPAFLRLPRNPAGRDFAVGDIHGHFSRLEQALDECGFDP
FT                   RRDRLFSVGDLIDRGPDSEAAVQWLAHPWFYAVQGNHEDYAIRHVRTGLVDQDNWRSYG
FT                   GGWFLDAAPERQRAWAGAFAALPVVIEVATQAGPVGLLHADCPVRDWSRLEYFLQARPK
FT                   RARSVCQWSRERLASGDARGVDGIRAVVAGHTPVSEPVVLGNVYHIDTQGWRPHGYFTL
FT                   LDLSTLSAWPRPAQAGAPAARG"
     atggccccga acctgcagta ccccgctttc ctgcgcctgc cgcgcaaccc cgccggacgc        60
     gacttcgccg tgggcgatat ccatggccat ttctcccgcc tcgagcaggc gctggacgaa       120
     tgcggcttcg atccgcggcg cgaccgcctg ttctcggtgg gagacctgat agaccggggg       180
     ccggacagcg aggccgcggt gcaatggctg gcgcatccgt ggttctacgc cgtgcagggc       240
     aaccacgagg actatgccat ccgccatgtg cgcaccggcc tggtcgacca ggacaattgg       300
     cgcagctatg gcggcggctg gtttctcgat gccgcgcccg agcgccagcg cgcctgggcc       360
     ggcgcgttcg cggccttgcc ggtggtgatc gaggtggcga cgcaggccgg cccggtgggc       420
     ttgctgcacg ccgattgccc ggtgcgggac tggagccggc tcgagtattt cctgcaggcg       480
     cggcccaagc gggcgcgctc ggtctgccag tggtcgcgcg agcggctggc cagcggcgac       540
     gcgcgcggcg tggacggcat ccgcgccgtg gtggcgggcc atacgccggt cagcgagccc       600
     gtggtgctgg gcaatgtcta tcacatcgac acccagggct ggcgtccgca tggctatttc       660
     accttgctcg acctctctac gctgagcgcc tggccgcgcc cggcgcaggc cggcgcgccg       720
     gccgcgcgcg gctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page