(data stored in ACNUC1104 zone)

EMBL: BX640427.PROC

BX640427.PROC        Location/Qualifiers
FT   CDS_pept        18896..19690
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BPP1311"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Similar to Pseudomonas aeruginosa
FT                   pyrroline-5-carboxylate reductase ProC or Pa0393
FT                   SWALL:PROC_PSEAE (SWALL:P22008) (272 aa) fasta scores: E():
FT                   1.2e-27, 45.45% id in 264 aa, and to Caulobacter crescentus
FT                   pyrroline-5-carboxylate reductase Cc0494 SWALL:Q9AAU9
FT                   (EMBL:AE005722) (260 aa) fasta scores: E(): 1.2e-23, 43.56%
FT                   id in 264 aa"
FT                   /db_xref="GOA:Q7WAQ8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ8"
FT                   /protein_id="CAE36613.1"
FT                   /translation="MRQALFLGYGRMGAALGEAWLRAGLLAGIDAVDPGRDGAGLRARL
FT                   VRGADELPEQAYDLVVLAVKPAMAQQALRPVPPARLARACLVSIMAGVPAGALRQALQP
FT                   PRPVARAMPNTPVMAGQGCTGLYGGDDVAPAQRAAIGRLFEAVGAAFWVDTEDQLHAVT
FT                   ALSGSGPAYYHLFSEALAQAGEQLGLPAALARSLAARTALGAASLQCEEGADFAALRRE
FT                   VTSPHGTTHAAIEVFEQAGALRTLVRDAVRQAQARSRELARP"
     atgaggcagg cattgtttct gggttacggc cggatgggcg cggcgctggg cgaagcctgg        60
     ctgcgcgccg gtttgctggc agggatagac gcggtcgatc cggggcgcga tggcgccggc       120
     ctgcgggcgc gcctggtgcg cggggcggac gaattgccgg agcaggccta cgacctggtg       180
     gtgctggcgg tgaagccggc catggcgcag caggccttgc gccccgtgcc gccggcgcgg       240
     ctggcgcgcg cctgcctggt gtccatcatg gccggcgtgc cggccggcgc attgcggcag       300
     gcgctgcagc cgccgcggcc ggtggcgcgg gccatgccca atacgccggt catggcgggg       360
     caaggctgca ccgggctgta cggcggcgac gatgtcgcgc ccgcgcagcg cgccgcgatc       420
     ggccgcctgt tcgaggccgt gggcgcggcg ttctgggtcg atacggaaga tcagctgcac       480
     gccgtgacgg cgttgagcgg cagcggtccg gcctactacc atctgttcag cgaggcgctg       540
     gcgcaggcgg gcgagcagct gggcctgccg gccgcgctgg cgcgcagcct ggcggcccgc       600
     acggcgctgg gcgcggccag cctgcagtgc gaggaaggcg ccgatttcgc cgcgctgcgc       660
     cgcgaggtga cctcgcccca cggcaccacc catgcggcga tcgaagtgtt cgagcaggcg       720
     ggggcgctgc gcacgctggt gcgcgatgcg gtgcggcagg cgcaggcgcg ctcgcgcgag       780
     ctggcgcggc cctag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page