(data stored in ACNUC1104 zone)

EMBL: BX640427.PYRH

BX640427.PYRH        Location/Qualifiers
FT   CDS_pept        242297..242959
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /gene_synonym="smbA"
FT                   /locus_tag="BPP1529"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1421"
FT                   /db_xref="GOA:Q7WA58"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA58"
FT                   /protein_id="CAE36831.1"
FT                   /translation="MGEDAFGINRSTIVRMTDEIAEVAALGVELAIVIGGGNIFRGVAP
FT                   GAQGMDRATADYMGMMATIMNALALQDALKHKGVDTRVQSALNIDQVVEPYIRPKALRY
FT                   LEEGKVVIFAAGTGNPFFTTDTAAALRGAEIGAEIVLKATKVDGIYSADPNKDPTATRY
FT                   ARISFDEAIVRRLEVMDATAFALCRDQKLPIKVFSINKFGALKRAVSGEDEGTLVHV"
     atgggcgaag atgcctttgg catcaatcgc tccaccatcg tccgcatgac cgatgagatc        60
     gccgaagtcg ccgcactggg cgtcgaactg gccatcgtca tcggcggagg caatattttc       120
     cgtggcgtcg ccccgggcgc gcagggcatg gaccgcgcga ccgccgacta catgggcatg       180
     atggcaacca tcatgaacgc gctggcgctg caggacgcgc tcaagcacaa gggcgtcgac       240
     acgcgggtgc agtcggcgct gaacatcgac caggtggtcg agccctacat ccggcccaag       300
     gccctgcgct acctcgaaga gggcaaggtc gtgatcttcg cggccggcac cggcaacccg       360
     ttcttcacca ccgataccgc ggccgcgctg cgcggtgcgg agatcggcgc cgaaatcgtg       420
     ctcaaggcaa ccaaggtcga cggcatctac agcgccgatc ccaacaagga tccgaccgcg       480
     acccgctacg cgcgcatcag cttcgacgaa gccatcgtgc gccggctcga ggtcatggac       540
     gccacggcgt tcgcgttgtg ccgtgaccaa aagctgccca tcaaagtgtt ttcgatcaac       600
     aagttcggcg ccctcaagcg ggccgtcagc ggcgaagacg aaggcacgct ggtacacgtt       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page