(data stored in ACNUC1104 zone)

EMBL: BX640427.SMPB

BX640427.SMPB        Location/Qualifiers
FT   CDS_pept        complement(262823..263290)
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /gene_synonym="smqB"
FT                   /locus_tag="BPP1549"
FT                   /product="SsrA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1442"
FT                   /db_xref="GOA:Q7WA41"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA41"
FT                   /protein_id="CAE36851.1"
FT                   /translation="MSIIDNRKATHDYFIEDRYEAGMVLEGWEVKAIRDGRVHLKESYV
FT                   IVRDGEIYLLGMHVSPLPTASTHIRPDATRTRKLLLKAEEIRKLIGKVEQRGYTLVPLN
FT                   LHYKNGRIKLDFALGRGKKLYDKRDTAREKDWQREKERVLKHDTRVNQRDS"
     atgagtatta tcgataaccg caaggccacg cacgactatt tcatcgagga ccgctacgaa        60
     gctggcatgg tcctggaagg atgggaagtg aaggctatcc gcgacggccg cgtgcacttg       120
     aaggaaagct acgtcatcgt gcgcgatggc gaaatctacc tgctgggcat gcacgtcagc       180
     ccgctgccta ccgcgtccac ccacatccgc cccgacgcca cgcgcacccg caagctgctg       240
     ctcaaggccg aggaaatccg caagctgatc ggcaaggtcg aacagcgcgg ctacacgctg       300
     gttccgctca acctgcacta caagaacggc cgcatcaagc tggacttcgc gctgggccgg       360
     ggcaagaagc tgtacgacaa gcgcgacacc gcccgcgaaa aggactggca gcgcgaaaag       420
     gaacgtgtcc tgaagcacga cacgcgcgtc aaccaacgcg attcctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page