(data stored in ACNUC1104 zone)

EMBL: BX640427.TSR

BX640427.TSR         Location/Qualifiers
FT   CDS_pept        186746..188452
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BPP1474"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1030"
FT                   /db_xref="GOA:Q7WAA6"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA6"
FT                   /protein_id="CAE36776.1"
FT                   /translation="MRKFLANLSIRGSLLGVLAFFSFMLVVGAALGVLSLRVSNDTLQG
FT                   VKQTQDVADAMDRVVNSYKDAFNGLGRAAASHYGAIVSAIGQPVQVEQGLGSEAAGLLQ
FT                   RAKASLNRAETEYEYYKGLARPASAADSLKEVENAFEALVGQGLHPLAAALEKGDMAGY
FT                   QSHAQNVLDALEGRFSGAIAAFDFWRASELLDAHEVAETRYRFVLAAVAAGGVLAALLV
FT                   FSTYLFLRRRVLQPLREVGQHFDKIAAGDLTARVDVRNSNEIGQLFAGLKRMEESLTRT
FT                   VAAVRRGVDEINVGSREISAGNTDLSSRTEEQAASLEETAASMEQLASTVKQNADNARQ
FT                   ANQLAGVASDVAERGGSAVSEVVATMQDISASSRKISEIVSVIDGIAFQTNILALNAAV
FT                   EAARAGEQGKGFAVVAGEVRSLAQRSAQAAKEIKVLIEDSVGKVGTGSQQVERAGATMQ
FT                   EIVASVKRVTDIMGEISAASEEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQ
FT                   EQAQRLAEAVAVFRINAGEVIEVPAHQLGSRQAPGARETALAHDDALALGH"
     atgcgcaagt tcctcgcgaa cctgtcgata cgcggcagcc tgttgggcgt gctggcgttc        60
     ttctctttca tgctggtcgt cggcgccgcc ctgggcgtgc tgtcgctgcg ggtcagcaac       120
     gacacgttgc agggagtcaa gcagacccag gatgtcgccg acgcgatgga tcgcgtcgtc       180
     aacagctaca aggacgcgtt caacggcctg ggccgcgccg cggcgtcgca ctatggcgcg       240
     atcgtgagcg cgatcggcca gccggtgcag gtcgaacagg gcctgggcag cgaggcggcg       300
     ggcttgctgc agcgcgccaa ggcttcgctc aaccgcgccg agaccgaata cgagtactac       360
     aagggcctgg ctcggccggc cagcgccgcc gacagcctga aagaagtcga gaacgccttc       420
     gaggcgctgg tcggccaggg gctccatccg ctggccgccg ccttggagaa gggcgacatg       480
     gccggctatc agtcgcatgc gcagaacgtc cttgacgcgc tggaaggacg tttctcgggc       540
     gccatcgccg cgttcgactt ctggcgcgcc agcgagctgc tcgacgccca cgaagtggct       600
     gagacgcgct atcgcttcgt gctggcggcc gtggccgcgg gcggggtgct ggccgcgctg       660
     ctggtgtttt cgacctatct gttcctgcgc cgccgcgtgc tgcagccttt gcgcgaagta       720
     ggccagcatt tcgacaagat cgccgcgggc gacctgaccg cgcgggtgga tgtgcgcaac       780
     agcaacgaga tcggccagct gttcgccggc ctcaagcgca tggaggaaag cctgacgcgt       840
     accgtcgcgg cggtgcgccg cggggtagac gagatcaacg tgggttcgcg cgagatctcg       900
     gccggcaaca cggacctgtc cagccgcacc gaggagcagg cggcctcgct ggaggagacc       960
     gcggcctcga tggagcagct ggcctcgacg gtcaagcaga atgccgacaa cgcgcgccag      1020
     gccaaccagc tggcgggagt cgcctcggac gtggccgagc gtggcggttc ggcggtgtcg      1080
     gaggtggtgg cgacgatgca ggacatctcg gccagctcgc gcaagatttc cgagattgtg      1140
     tcggtgatcg acgggatcgc gttccagacc aacatcctgg cgctgaacgc ggcggtggaa      1200
     gcggcgcgcg cgggcgagca gggcaagggt ttcgcggtgg tggcgggcga agtgcgctcg      1260
     ctggcgcagc gcagcgccca ggcggccaag gagatcaagg tgctgatcga ggactcggtc      1320
     ggcaaggtgg gcacgggctc gcagcaggtc gagcgcgccg gtgcgacgat gcaggagatc      1380
     gtggcctcgg tcaagcgggt gacggacatc atgggcgaga tttcggcggc ctcggaagag      1440
     cagtccagcg ggatcgagca ggtcaaccgc gcggtgtcgc agatggacga ggtaacgcag      1500
     cagaacgcgg cgctggtgga agaggcggcc gcggcggccg gttcgctgca ggagcaggcg      1560
     cagcgcctgg ccgaggcggt cgcggtgttc aggatcaatg ccggcgaggt gatcgaagtg      1620
     ccggcgcacc aactgggatc gaggcaggcg ccgggtgcgc gcgagacggc gctggcgcac      1680
     gatgacgcgc tggcgctggg gcactga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page