(data stored in ACNUC9435 zone)

EMBL: BX936399.PE1

BX936399.PE1         Location/Qualifiers
FT   CDS_pept        complement(12..2210)
FT                   /transl_table=11
FT                   /locus_tag="pYV0001"
FT                   /product="ypkA; putative targeted effector protein kinase"
FT                   /note="similar to Y. pestis YPCD1.72c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25344"
FT                   /db_xref="GOA:Q05608"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003547"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR019093"
FT                   /db_xref="PDB:2H7O"
FT                   /db_xref="PDB:2H7V"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05608"
FT                   /protein_id="CAF25344.1"
FT                   /translation="MKSVKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRIID
FT                   NQVLRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTDTLHAAQKTTSQELRSDIPNAL
FT                   SNLFGAKPQTELPLGWKGEPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRLVAK
FT                   IERSIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVDGWRC
FT                   SDTLRTLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGVVHNDIKPGNVVFDRA
FT                   SGEPVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLHCIEGFE
FT                   KNPEIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVSADSRPDS
FT                   NEARLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSDLLRTHLSS
FT                   AATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVIEDYVKGREG
FT                   DTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAHKHLETLLEVL
FT                   VTLSQQGQPVSSETYGFLNRLAEAKITLSQQLNTLQQQQESAKAQLSILINRSGSWADV
FT                   ARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDDMRNFTVDSIPLL
FT                   IQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
     atgaaaagcg tgaaaatcat gggaactatg ccaccgtcga tctccctcgc caaagctcat        60
     gagcgcatca gccaacattg gcaaaatcct gtcggtgagc tcaatatcgg aggaaaacgg       120
     tatagaatta tcgataatca agtgttgcgc ttgaaccccc acagtggttt ttctctcttt       180
     cgagaagggg ttggtaagat cttttcgggg aagatgttta acttttcaat tgctcgtaac       240
     cttactgaca cactccatgc ggcccagaaa acgacttcgc aggagctaag gtctgatatc       300
     cccaatgctc tcagtaatct ctttggagcc aagccacaga ccgaactgcc gctgggttgg       360
     aaaggggagc ccttgtcagg agctccggat cttgaaggga tgcgagtggc tgaaaccgat       420
     aagtttgccg agggcgaaag ccatattagt ataatagaaa ctaaggataa gcagcggttg       480
     gtagctaaga ttgaacgctc cattgccgag gggcatttgt tcgcagaact ggaggcttat       540
     aaacacatct ataaaaccgc gggcaaacat cctaatcttg ccaatgttca tggcatggct       600
     gtggtgccat acggtaaccg taaggaggaa gcattgctga tggatgaggt ggatggttgg       660
     cgttgttctg acacactaag aaccctcgcc gatagctgga agcaaggaaa gatcaatagt       720
     gaagcctact ggggaacgat caagtttatt gcccatcggc tattagatgt aaccaatcac       780
     cttgccaagg caggggtagt acataacgat atcaaacccg gtaatgtggt atttgaccgc       840
     gctagcggag agcccgttgt tattgatcta ggattacact ctcgttcagg ggaacaacct       900
     aaggggttta cagaatcctt caaagcgccg gagcttggag taggaaacct aggcgcatca       960
     gaaaagagcg atgtttttct cgtagtgtca acccttctac attgtatcga aggttttgag      1020
     aaaaatccgg agataaagcc taatcaagga ctgagattca ttacctcaga accagcgcac      1080
     gtaatggatg agaatggtta tccaatccat cgacctggta tagctggagt cgagacagcc      1140
     tatacacgct tcatcacaga catccttggc gtttccgctg actcaagacc tgattccaac      1200
     gaagccagac tccacgagtt cttgagcgac ggaactatcg acgaggagtc ggccaagcag      1260
     atcctaaaag ataccctaac cggagaaatg agcccattat ctactgatgt aaggcggata      1320
     acacccaaga agcttcggga gctatctgat ttgcttagga cgcatttgag cagtgcagca      1380
     actaagcaat tggatatggg gggggttttg tcggatcttg ataccatgtt ggtggcactc      1440
     gacaaggccg aacgcgaggg gggagtagac aaggatcagt tgaagagttt taacagtttg      1500
     attctgaaga cttacagagt gattgaagac tatgtcaaag gcagagaagg ggataccaag      1560
     aattccagta cggaagtatc cccctatcat cgcagtaact ttatgctatc gatcgtcgaa      1620
     ccttcactgc agaggatcca gaagcatctg gaccagacac actctttttc tgatatcggt      1680
     tcactagtgc gcgcacataa gcacctggaa acgcttttag aggtcttagt caccttgtca      1740
     cagcaagggc agcccgtgtc ctctgaaacc tacggcttcc tgaatcgatt agctgaggct      1800
     aagatcacct tgtcgcagca attgaacact ctccagcagc agcaggagag tgcgaaagcg      1860
     caactatcta ttctgattaa tcgttcaggt tcttgggccg atgttgctcg tcagtccctg      1920
     cagcgttttg acagtacccg gcctgtagtg aaattcggca ctgagcagta taccgcaatt      1980
     caccgtcaga tgatggcggc ccatgcagct attacgctac aggaggtatc ggagtttact      2040
     gatgatatgc gaaactttac agtggactct attccactac tgattcaact tggacgaagc      2100
     agtttaatgg atgagcattt ggttgaacag agagaaaagt tgcgagagct gacgaccatc      2160
     gccgagcgac tgaaccggtt ggagcgggaa tggatgtga                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page