(data stored in ACNUC9435 zone)

EMBL: BX936399.PE13

BX936399.PE13        Location/Qualifiers
FT   CDS_pept        complement(9103..10401)
FT                   /transl_table=11
FT                   /locus_tag="pYV0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25356"
FT                   /db_xref="GOA:P10858"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008126"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10858"
FT                   /protein_id="CAF25356.1"
FT                   /translation="MTKDFKISVSAALISALFSSPYAFAEEPEDGNDGIPRLSAVQISP
FT                   NVDPKLGVGLYPAKPILRQENPKLPPRGPQGPEKKRARLAEAIQPQVLGGLDARAKGIH
FT                   SIAIGATAEAAKPAAVAVGAGSIATGVNSVAIGPLSKALGDSAVTYGASSTAQKDGVAI
FT                   GARASASDTGVAVGFNSKVDAQNSVAIGHSSHVAADHGYSIAIGDLSKTDRENSVSIGH
FT                   ESLNRQLTHLAAGTKDNDAVNVAQLKKEMAETLENARKETLAQSNDVLDAAKKHSNSVA
FT                   RTTLETAEEHANKKSAEALVSAKVYADSNSSHTLKTANSYTDVTVSSSTKKAISESNQY
FT                   TDHKFSQLDNRLDKLDKRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIG
FT                   SGYRVNESVALKAGVAYAGSSNVMYNASFNIEW"
     atgactaaag attttaagat cagtgtctct gcggcattaa tatctgcgtt gttctcatct        60
     ccatatgcat ttgccgagga gcccgaggat ggcaacgatg gtattcctcg tttgtcagca       120
     gttcaaataa gcccaaatgt tgatcctaaa ttgggtgtgg gattatatcc agcaaaacca       180
     atattacgtc aagaaaaccc aaaattacct ccacgaggtc cacaaggtcc agaaaaaaaa       240
     agagctagat tagcagaagc aatacaaccg caagtactag gcgggctcga tgctcgcgct       300
     aagggtatcc atagcattgc gattggtgct actgctgaag cagcgaaacc agcagcagtt       360
     gctgtgggcg ctggttcaat tgcaacaggc gttaattctg ttgcaattgg tcctttaagt       420
     aaggcattgg gagattcggc agttacttat ggggcaagta gtaccgccca gaaagatgga       480
     gtagctatcg gtgcgagagc atcagcttcg gatactggtg tcgctgtcgg ttttaactcg       540
     aaagttgatg cacaaaactc tgttgccatt ggacactcta gtcacgttgc ggcagatcat       600
     ggttattcaa ttgcaattgg ggatctttct aaaactgacc gagagaatag tgtatccatt       660
     ggtcatgaaa gccttaatcg ccaattaaca catcttgcgg ctggcactaa agacaatgat       720
     gcagtgaatg tcgcgcaatt aaagaaagaa atggctgaaa cattggaaaa tgcacgtaaa       780
     gagactttgg ctcagtctaa cgatgttttg gatgcggcca aaaaacactc aaatagtgtt       840
     gccagaacaa ctttagaaac tgctgaagaa catgcaaata aaaaatcagc tgaggcgtta       900
     gtaagcgcta aagtgtatgc agacagcaat tcttctcaca cactaaaaac tgcaaatagc       960
     tataccgatg tgactgtaag tagttcgact aagaaagcaa tcagtgaatc taatcaatac      1020
     acagatcata aattcagtca acttgacaac cgtttagata aacttgacaa acgagttgac      1080
     aaaggtttag ccagttcagc cgctttaaac agcttgttcc agccatatgg tgtagggaaa      1140
     gtaaacttta ctgcaggtgt cgggggatat cgttctagtc aggcattagc aattggttct      1200
     ggctatcgtg taaatgagag tgtcgcactt aaagccggtg tggcttatgc cggttcctcg      1260
     aatgtcatgt acaacgcatc atttaatatc gagtggtaa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page