(data stored in ACNUC9435 zone)

EMBL: BX936399.PE16

BX936399.PE16        Location/Qualifiers
FT   CDS_pept        complement(11386..13701)
FT                   /transl_table=11
FT                   /locus_tag="pYV0016"
FT                   /product="tnpA; putative transposase protein"
FT                   /note="similar to Y. pestis YPCD1.90c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25359"
FT                   /db_xref="GOA:Q663P8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P8"
FT                   /protein_id="CAF25359.1"
FT                   /translation="MPVDFLTTEQEQNYGCYVAEPNDVQLVRYFHLDERDLAFIYQRRG
FT                   KHNRLGIALQLTTARFLGTFITDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDTTRRE
FT                   HTAQIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKILLPGA
FT                   TTLVRLVSEIRERANQRLWKKLAAIHYLTELNGTKKRLLDDAPEHIITGPWKRLVYDAE
FT                   GRIQRAGYSLCLLERLQDALRRRDIWLKNSDRWGDLREKLLQGEEWQAQRVLVCRALGH
FT                   PTDGHKGVQQLAVQLDETWRAVASRFEGNTEVHICNDGKYPSLTISSLEKLEEPLSLLR
FT                   LNNRVRQLLPPVDLTELLLEIDARTGFTREFTHVSESGARAQDLHISLCAVLMAEACNI
FT                   GLEPLIKHNIPALTRHRLSWMKQNYLQAETLVSANARLVDFQSTLELARRWGGGEVASV
FT                   DGMRFVTPVKTVNSGPNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLRDSIFVLEGL
FT                   LEQQTGLNPVEIMTDTAGTSDIIFGLFWLLGYQFSPRLADAGEAVFWRVDKSANYGALD
FT                   ELARGCADLSKAENQWDEMMRTAGSLKLGTIHASELIRSLLKSSRPSGLAQAIMAVGRV
FT                   NKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICYGQRGEIRKRYREGQEDQLGAL
FT                   GLVTNAVVLWNTLYMQEALSWMRSNGEETRDEDIARLSPLMHGHINMLGHYTFTLSDDI
FT                   LNGELRALNFNLNNELSP"
     atgccagtcg attttctgac cactgagcaa gaacagaatt acggttgtta cgttgcagaa        60
     cccaatgacg tgcaactggt gcgctatttt catcttgacg agcgggatct tgctttcatt       120
     taccagcggc ggggaaagca taaccgcctg ggaatagcac ttcagctcac aacggcccgt       180
     tttctgggaa cctttattac ggatttaacc caagttctgc caggtgttca gcattttgtc       240
     gctgtacagc ttaatatacg ccgtccggaa gtcctctccc gctatgccga gcgtgacacc       300
     actcgcaggg aacataccgc gcagataaag gaatattacg gctatcatga atttggtgat       360
     tttccgtggt ctttccgcct gaaacgtctg ctgtacaccc gtgcatggct cagcaatgaa       420
     cgccccggtc tgatgtttga ttttgccact gcgtggctgc ttcagaataa gattctgttg       480
     cccggagcaa ccacacttgt acgtctcgtc agtgaaatac gcgaaagggc aaatcagcgg       540
     ctctggaaaa agctggccgc cattcattat ctgaccgaac taaacggcac gaaaaaacgc       600
     ctcctggatg atgctcctga acatattatt accggcccct ggaaacgcct ggtgtacgat       660
     gcggagggcc ggatacaacg tgccggttac tcgctttgtc tgctggagcg ccttcaggat       720
     gcattgagac gccgggacat ctggctgaaa aatagcgatc gctggggaga tctccgcgag       780
     aagttgttgc agggggaaga gtggcaggct cagcgggtcc tcgtctgccg ggcgttggga       840
     catcccaccg atggacataa aggcgtacaa cagttggcgg tccaactgga tgaaacctgg       900
     agagcagttg catcccgctt tgaaggaaat acggaagtcc atatctgcaa tgacggtaaa       960
     tatccttccc tgactatcag cagtctggag aaattggagg agccactgtc gttgcttcgt      1020
     ctaaacaatc gggtcaggca actgctacca ccggtagatt tgacggaact gttgcttgaa      1080
     atagatgcca gaacgggatt tacacgtgag tttacacatg tcagtgaatc cggggctcga      1140
     gcgcaagatc tgcacatcag cctgtgcgcg gtactgatgg ctgaagcctg caatatcggg      1200
     ctggaaccgc tgataaagca caatataccg gcactgacgc gccaccggct cagttggatg      1260
     aaacagaatt accttcaggc agaaacgctg gtcagcgcca atgcccggtt agttgatttt      1320
     cagtccacgc tggagcttgc tcgccgctgg ggtggcggcg aggtggcttc agttgacggt      1380
     atgcgctttg tcacgccagt gaaaacggtc aattccgggc cgaacagaaa atattttggc      1440
     tccgggcgtg gcatcacctg gtacaacttc gtctctgatc agtactctgg attccacggc      1500
     atcgttgtcc ccggcacatt acgggattcc atttttgtgc tggaaggcct tctggaacag      1560
     cagacagggc tgaatccggt tgagatcatg acagacacag ccggtaccag cgacattata      1620
     tttggcctgt tctggctact tgggtatcag ttttcccccc gtctggctga tgccggtgaa      1680
     gctgtattct ggcgagtgga taaatcggca aattacggag cacttgatga gcttgctcgt      1740
     gggtgtgcag atctgtcgaa ggcagaaaat cagtgggatg agatgatgcg aactgcgggt      1800
     tcgctcaagc tgggcaccat tcatgcttca gaactcattc gctcactact gaaaagctca      1860
     cggccgtcag ggctggctca ggccatcatg gcggtggggc gtgtaaacaa gacgctgtat      1920
     cttcttaatt atattgatga tgaagattat cgtcgccgga tcctgacgca actcaatcgg      1980
     ggagagagcc gccatgccgt ggcacgtgca atttgttacg ggcagcgcgg tgagatcaga      2040
     aaacgctacc gtgaggggca ggaagatcaa ctgggcgcat tggggctggt cactaacgca      2100
     gtggtactgt ggaacacgct ttatatgcag gaagcactga gctggatgcg cagtaatgga      2160
     gaagaaacca gggatgagga tatcgcccgg ttatctccac tgatgcacgg gcatatcaat      2220
     atgctggggc attatacgtt cacgctatcg gatgatattt taaacggaga actgagagca      2280
     ttaaatttca atttaaacaa tgaattatct ccttaa                                2316
//

If you have problems or comments...

PBIL Back to PBIL home page