(data stored in ACNUC9435 zone)

EMBL: BX936399.PE2

BX936399.PE2         Location/Qualifiers
FT   CDS_pept        complement(2218..2667)
FT                   /transl_table=11
FT                   /locus_tag="pYV0002"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.73c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25345"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G5"
FT                   /protein_id="CAF25345.1"
FT                   /translation="MINTTFTELLPKIASHFGLDKLSQDEYGLCELILNDRVVIMLRAD
FT                   EILNRLTLLGPILGFSGPEARSAASQLFFCYSINALNKDGPCFAWSEELGLIAFKHLSL
FT                   DELNVENVSKEIANFYDWLSLVSLPAETQQELPLHTQSTQSVKWG"
     gtgattaaca ccacctttac tgagctactc ccaaaaatag caagtcactt tggattagat        60
     aaattgagcc aagatgaata tggcttgtgt gagcttatcc tcaacgaccg agtcgttatt       120
     atgctgaggg ctgatgaaat attgaatcga ttgactctgt tggggccaat cttaggattt       180
     tctggaccag aggcgcgcag cgccgctagt cagctttttt tctgttatag catcaatgcc       240
     ttgaataagg acggcccttg tttcgcttgg agtgaagaac tggggctgat cgcattcaag       300
     cacctttctc tcgacgagct gaatgttgag aacgttagca aggagatagc gaacttttac       360
     gactggttga gcttggtcag tttaccagca gaaactcagc aggaactgcc ccttcatact       420
     caatctactc aatcggttaa atggggatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page