(data stored in ACNUC9435 zone)

EMBL: BX936399.PE20

BX936399.PE20        Location/Qualifiers
FT   CDS_pept        complement(16714..17139)
FT                   /transl_table=11
FT                   /locus_tag="pYV0020"
FT                   /product="sycH; putative yopH targeting protein"
FT                   /note="similar to Y. pestis YPCD1.95c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25363"
FT                   /db_xref="GOA:I3NIC8"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:I3NIC8"
FT                   /protein_id="CAF25363.1"
FT                   /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINE
FT                   KELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQ
FT                   LASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV"
     atgcgcactt acagttcatt acttgaagaa tttgctacag agctaggtct tgaagaaata        60
     gaaacaaatg agttagggca tggggctgtt accattgata aaatatgggt agtacatctg       120
     gcacctatca atgagaagga gttagtggct tttatgcggg cagggatctt gactggtcag       180
     tctcaacttt atgatatttt gcggaaaaac ctctttagcc cactatctgg tgtaattcgt       240
     tgtgcgcttg ataaagatga tcactggcta ttgtggagtc agttaaacat taatgacacc       300
     agtgggacgc aactggcgag cgtattgacg tcgctggttg ataaagctgt tactctttct       360
     tgtgaaccca caatgaagaa agaggaggat gatcatcgtc cttcatcatc tcatttactg       420
     gtttaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page