(data stored in ACNUC9435 zone)

EMBL: BX936399.PE25

BX936399.PE25        Location/Qualifiers
FT   CDS_pept        20483..21142
FT                   /transl_table=11
FT                   /locus_tag="pYV0025"
FT                   /product="putative outer membrane virulence protein"
FT                   /note="identical to Y. pestis YPCD1.06"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25368"
FT                   /db_xref="GOA:P08008"
FT                   /db_xref="InterPro:IPR003537"
FT                   /db_xref="InterPro:IPR014773"
FT                   /db_xref="InterPro:IPR015110"
FT                   /db_xref="InterPro:IPR037168"
FT                   /db_xref="PDB:1L2W"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08008"
FT                   /protein_id="CAF25368.1"
FT                   /translation="MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQTSDQYANNLAG
FT                   RTESPQGSSLASRIIERLSSVAHSVIGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSFSD
FT                   SIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQA
FT                   EASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM"
     atgaaaatat catcatttat ttctacatca ctgcccctgc cgacatctgt gtcaggatct        60
     agcagcgtag gagaaatgtc tgggcgctca gtctcacagc aaacaagtga tcaatatgca       120
     aacaatctgg ccgggcgcac tgaaagccct cagggttcca gcttagccag ccgtatcatt       180
     gagaggttat catcagtggc ccactctgtg attgggttta tccaacgcat gttctcggag       240
     gggagccata aaccggtggt gacaccagca cccacacctg cacaaatgcc aagtcctacg       300
     tctttcagtg acagtatcaa gcaacttgct gctgagacgc tgccaaaata catgcagcag       360
     ttgaatagct tggatgcaga gatgctgcag aaaaatcatg atcagttcgc tacgggcagc       420
     ggccctcttc gtggcagtat cactcaatgc caagggctga tgcagttttg tggtggggaa       480
     ttgcaagctg aggccagtgc catcttaaac acgcctgttt gtggtattcc cttctcgcag       540
     tggggaacta ttggtggggc ggccagcgcg tacgtcgcca gtggcgttga tctaacgcag       600
     gcagcaaatg agatcaaagg gctggcgcaa cagatgcaga aattactgtc attgatgtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page