(data stored in ACNUC9435 zone)

EMBL: BX936399.PE26

BX936399.PE26        Location/Qualifiers
FT   CDS_pept        complement(21282..21581)
FT                   /transl_table=11
FT                   /locus_tag="pYV0026"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.08c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25369"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N8"
FT                   /protein_id="CAF25369.1"
FT                   /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKN
FT                   PELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPEHE"
     gtgtataaac tgtctgaact agctgatgag gatatttata atattgccag ttatactatc        60
     cggcatttcg gtgtgactca ggctaagtta taccatgaga acttggcaaa ggtattcgag       120
     ctattagcta aaaatccaga gttaggggct gagtgtaact ggatttgctc tgatattcgc       180
     cgttttcagt ataaaaagca cggtatatac tatataacgc ttagcaatga tattttgatt       240
     tctcgagtgc tgcatcaatc catagatata gatgttcagg attttccaga gcatgagtag       300
//

If you have problems or comments...

PBIL Back to PBIL home page