(data stored in ACNUC9435 zone)

EMBL: BX936399.PE27

BX936399.PE27        Location/Qualifiers
FT   CDS_pept        complement(21574..21849)
FT                   /transl_table=11
FT                   /locus_tag="pYV0027"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.09c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25370"
FT                   /db_xref="GOA:Q663N7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N7"
FT                   /protein_id="CAF25370.1"
FT                   /translation="MYYSVIHNGGDMAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLR
FT                   DALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKGTSV"
     ttgtattact cagtaataca taacggaggg gatatggctc acgtaaccag cgtaacactt        60
     ggagagcatt tgacaggttt tgtgggggaa atgattcagt ctggtcgtta tggcaatata       120
     tcagaagtgc ttcgtgatgc cttaaggcta atggaagcac gtgaacagcg tgttcaacat       180
     gtacgcgata tggtgcttgc aggaacaaat gtacctgtga gccatcgttt aatggatgag       240
     attttttctg ctgcggtgaa aggtactagt gtataa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page