(data stored in ACNUC9435 zone)

EMBL: BX936399.PE29

BX936399.PE29        Location/Qualifiers
FT   CDS_pept        22359..22532
FT                   /transl_table=11
FT                   /locus_tag="pYV0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25372"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N5"
FT                   /protein_id="CAF25372.1"
FT                   /translation="MKSPYPTWRDGYRYQKADIMLNDVGSRPGQIDMFDETPPHANSKH
FT                   LMQVVDASIALG"
     atgaaatcgc cgtatccaac ctggcgggat ggatatcgct atcaaaaagc cgacatcatg        60
     cttaatgacg tcggcagtcg accaggtcag atagatatgt ttgatgaaac accgccgcac       120
     gcgaacagta aacatctgat gcaagttgtt gatgcatcaa tagctctggg ctaa             174
//

If you have problems or comments...

PBIL Back to PBIL home page