(data stored in ACNUC9435 zone)

EMBL: BX936399.PE30

BX936399.PE30        Location/Qualifiers
FT   CDS_pept        complement(22682..22975)
FT                   /transl_table=11
FT                   /locus_tag="pYV0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25373"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N4"
FT                   /protein_id="CAF25373.1"
FT                   /translation="MDIQVGPWSQLLTLALDIQVGPWSQLPTLALDIQVGPWSQLLTLA
FT                   LDIQVGPWSQLPTLTLDIQVGPWSQLPTLALDIQVGPWSQLLTLALNILVEM"
     ttggatatcc aggtgggacc gtggtcccaa ttactaacgt tggcattgga tatccaggtg        60
     ggaccgtggt cccaattacc aacgttggca ttggatatcc aggtgggacc gtggtcccaa       120
     ttactaacgt tggcattgga tatccaagtg ggaccgtggt cccaattacc aacgttgaca       180
     ttggatatcc aggtgggacc gtggtcccaa ttaccaacgt tggcattgga tatccaagtg       240
     ggaccgtggt cccaattact aacactggca ttgaacatcc tagtggaaat gtga             294
//

If you have problems or comments...

PBIL Back to PBIL home page