(data stored in ACNUC9435 zone)

EMBL: BX936399.PE31

BX936399.PE31        Location/Qualifiers
FT   CDS_pept        complement(23123..24088)
FT                   /transl_table=11
FT                   /locus_tag="pYV0031"
FT                   /product="sopB; putative plasmid partitioning control
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.12c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25374"
FT                   /db_xref="GOA:Q663N3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N3"
FT                   /protein_id="CAF25374.1"
FT                   /translation="MMKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSGM
FT                   KGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLTSG
FT                   QQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYRPTS
FT                   AYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAGLPLKTIQLFANPNELSA
FT                   RSGEALSKAYENNVDTLKRVTYKIMKQKQEGRQFTTEELIVLLMPERKQPENIHKKSFG
FT                   KNIEAKYSKDNVSFYLKSVPESLVKQIEELLNTYAKEHSL"
     atgatgaaaa ggtcaccagt gttacgtaat gcgccttcaa ttaattttga tgatgctaaa        60
     cccgcaatca gcaatgcaga gccctcggtt tctgctccgg cggtgagtca gcttgcttct       120
     cgagttagtg gcatgaaagg caacacaatc gtattacctg tttgtggaag gaacgttgct       180
     tttacgctta aagtgatagc agcacctgat gttgaatcta aaacaatcgt ttttagtggt       240
     aatgagcgaa accaagcatt attaagtgag acgtcgttag atgacttgat cccttcattt       300
     ttaacgtcag ggcagcagat ccccgccttt gcacgtgaac ataacgggaa catcgaggtt       360
     gctgatggaa gtcgccgacg taaagccgcg atactcaccg gaagtgacta taaggttctg       420
     gttggtaact tgaatgatga gcagatgcta tggctgtccc aaattgctaa tgagtatcgt       480
     ccgacgagtg cttatgaacg aggcctgcgt tacgcccaac ggctaatatc tgaatttgaa       540
     ggtaatatta gtaaattggc agaggccgag catctctctc gcaaaattat tcagcgttgt       600
     attaaaacgg ctgggctgcc ccttaaaact attcaactgt ttgctaaccc taatgaatta       660
     agtgctcgta gtggcgaagc attaagtaaa gcttatgaaa ataatgttga tacgctaaag       720
     cgagttacgt ataaaattat gaagcaaaaa caggaaggtc gccagtttac tacggaagaa       780
     ttaatcgtat tgctgatgcc tgagagaaaa caaccagaga acattcataa aaaaagcttt       840
     ggcaaaaata tagaagcaaa atattcaaaa gacaatgttt ctttctatct caaatctgtg       900
     ccagagtcct tggttaaaca aatagaagaa ctcttgaata cctatgcaaa ggaacattct       960
     ttgtag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page