(data stored in ACNUC9435 zone)

EMBL: BX936399.PE33

BX936399.PE33        Location/Qualifiers
FT   CDS_pept        25800..25913
FT                   /transl_table=11
FT                   /locus_tag="pYV0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25376"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N1"
FT                   /protein_id="CAF25376.1"
FT                   /translation="MPKSLNAAKWVSIARIMAEGTAYEVEPDLCFTALGTV"
     ttgcccaaga gcctgaacgc cgcaaagtgg gtatcgattg cccgcatcat ggccgagggc        60
     acggcgtatg aggttgaacc ggatctctgt tttactgctc tggggactgt ttga             114
//

If you have problems or comments...

PBIL Back to PBIL home page