(data stored in ACNUC9435 zone)

EMBL: BX936399.PE36

BX936399.PE36        Location/Qualifiers
FT   CDS_pept        complement(26842..27102)
FT                   /transl_table=11
FT                   /locus_tag="pYV0036"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.85"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25379"
FT                   /db_xref="GOA:Q663M8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M8"
FT                   /protein_id="CAF25379.1"
FT                   /translation="MSRVVKYQRSTIEVARALELDPSQLRKWIHQYKEEVSGVTPDNPA
FT                   LIPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLR"
     ttgagccggg tcgttaagta tcagcggtca accatcgagg ttgcacgcgc tctggagctg        60
     gatcccagcc aattgcgtaa atggatacac cagtacaaag aagaagtcag cggggtgacg       120
     ccggacaatc ctgcactgat accagagcaa cgtgaaatcc agtcgctcag ggcgcagatt       180
     aaacggctgg aaatggaaaa agaaatacta aagcaggcag ccgtgttgat gagcgagttc       240
     cccatcaaat ctttgcgtta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page