(data stored in ACNUC9435 zone)

EMBL: BX936399.PE4

BX936399.PE4         Location/Qualifiers
FT   CDS_pept        complement(3411..3650)
FT                   /transl_table=11
FT                   /locus_tag="pYV0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25347"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G3"
FT                   /protein_id="CAF25347.1"
FT                   /translation="MSKKHYCRLHDLNIATFYYWLKHHQDDTTVAIPPAFIPARRVIPD
FT                   NNGTEAVTLNLPNGCSVSCLPAQLRAVMQALSLC"
     atgtctaaaa aacactactg tcggctgcat gacttgaaca tcgccacctt ttattactgg        60
     ctcaaacatc atcaagatga caccaccgtt gccattcccc ctgcgtttat ccccgctcgc       120
     cgggtaatac cagacaataa cggtaccgag gcagtgaccc tcaacctccc caatggctgt       180
     tcggtcagtt gtcttcctgc tcagttacgc gctgttatgc aggccttatc cctatgttga       240
//

If you have problems or comments...

PBIL Back to PBIL home page