(data stored in ACNUC9435 zone)

EMBL: BX936399.PE44

BX936399.PE44        Location/Qualifiers
FT   CDS_pept        31576..31995
FT                   /transl_table=11
FT                   /locus_tag="pYV0044"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.23"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25387"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M2"
FT                   /protein_id="CAF25387.1"
FT                   /translation="MSKIPTLIICSKPAEIAVGHFITMSIKAILLYSYQEYGQHTDVFI
FT                   QVKFNYGMIEYKFYVNKVKFDNTPGRKLKTTIAHSSQLMGHNLTYEDYAMKKRLVIATA
FT                   LCAAFYAGMKVEHFLTVDACLDAGGAMQNDIFCER"
     atgagtaaaa taccgactct cattatttgc agcaaacccg ccgaaattgc tgtagggcac        60
     tttattacca tgagcattaa ggctatatta ttatattcat atcaggaata tggtcagcac       120
     accgatgttt ttattcaagt aaagtttaat tatggtatga tagaatataa attctatgta       180
     aataaagtaa aattcgataa taccccgggc agaaagctca agacaacgat agctcactct       240
     tctcagctca tggggcataa tctaacctac gaggactatg caatgaaaaa acgactagtg       300
     atagccaccg cattgtgcgc tgctttttat gctggtatga aagttgagca ctttctgaca       360
     gtagatgctt gcctggatgc tggcggagct atgcagaatg atatcttctg tgaacgttaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page