(data stored in ACNUC9435 zone)

EMBL: BX936399.PE45

BX936399.PE45        Location/Qualifiers
FT   CDS_pept        complement(32524..32715)
FT                   /transl_table=11
FT                   /locus_tag="pYV0045"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.24c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25388"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M1"
FT                   /protein_id="CAF25388.1"
FT                   /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRDEPEYRV
FT                   REGSTFMNRLFNIEVVLA"
     ttggtaaacg cggccgggga tttcaaacgg ccaaaccgtg cctggtcaac gcttcaggga        60
     tttgaaacat tgcgacgact gaataaaggt caatttgata tttggttacg ccgtgacgaa       120
     cctgaatatc gagtgcggga aggatctacc tttatgaatc ggctctttaa cattgaggtt       180
     gttttagcct aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page