(data stored in ACNUC9435 zone)

EMBL: BX936399.PE47

BX936399.PE47        Location/Qualifiers
FT   CDS_pept        complement(33232..34884)
FT                   /transl_table=11
FT                   /locus_tag="pYV0047"
FT                   /product="yopM; putative targeted effector protein"
FT                   /note="similar to Y. pestis YPCD1.26c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25390"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L9"
FT                   /protein_id="CAF25390.1"
FT                   /translation="MYGFVCSEKLDNKNIFRKAFNMFINPRNVSNTFLQEPLRHSSNLT
FT                   EMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGL
FT                   SSLPELPPHLESLVASCNSLTELPELPQSLKSLQVENNNLKALPDLPPSLKKLHVREND
FT                   LTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYAD
FT                   NNLLETLPDLPPSLKKLHVRENDLTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTA
FT                   SSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPHLEILVASYNSLTELPELPQSLKS
FT                   LRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPS
FT                   LKKLHVRENDLTDLPELPQSLTFLDVSDNNISGLSELPPNLYYLDASSNEIRSLCDLPP
FT                   SLVDLNVKSNQLSELPALPPHLERLIASFNYLAEVPELPQNLKQLHVEQNALREFPDIP
FT                   ESLEELEMDSERVVDPYEFAHETTDKLEDDVFE"
     atgtatggtt ttgtttgcag tgaaaaactc gataataaaa atattttcag aaaggcattc        60
     aatatgttca taaatccaag aaatgtatct aatacttttt tgcaagaacc attacgtcat       120
     tcttctaatt taactgagat gccggttgag gcagaaaatg ttaaatctaa gactgaatat       180
     tataatgcat ggtcggaatg ggaacgaaat gcccctccgg ggaatggtga acagagggaa       240
     atggcggttt caaggttacg agattgcctg gaccgacaag cccatgagct agaactaaat       300
     aatctggggc tgagttcttt gccggaatta cctccgcatt tagagagttt agtggcgtca       360
     tgtaattctc ttacagaatt accggaattg ccgcagagcc tgaaatcact tcaagttgaa       420
     aataacaatc tgaaggcatt acccgattta cccccttccc tgaaaaaact tcatgtcaga       480
     gaaaatgatt taactgatct gccagaatta ccgcagagcc tggaatcact tcgagttgat       540
     aataacaatc tgaaggcatt atccgattta cctccttcac tggaatatct tactgctagt       600
     agtaataagc tggaagaatt gccagagttg caaaacttgc ccttcttggc tgcgatttat       660
     gctgataaca atttactgga aacattaccc gatttacccc cttccctgaa aaaacttcat       720
     gtcagagaaa atgatttaac tgatctgcca gaattaccgc agagcctgga atcacttcga       780
     gttgataata acaatctgaa ggcattatcc gatttacctc cttcactgga atatcttact       840
     gctagtagta ataagctgga agaattgcca gagttgcaaa acttgccctt cttggctgcg       900
     atttatgctg ataacaattt actggaaaca ttacccgatt tacccccgca tttagagatt       960
     ttagtggcgt catataattc tcttactgaa ttaccggaat tgccgcagag cctgaaatca      1020
     cttcgagttg ataataacaa tctgaaggca ttatccgatt tacctccttc actggaatat      1080
     cttactgcta gtagtaataa gctggaagaa ttaccagagt tgcaaaactt gcccttcttg      1140
     gctgcgattt atgctgataa caatttactg gaaacattac ccgatttacc cccttccctg      1200
     aaaaaacttc atgtcagaga aaatgattta actgatctgc cagaattacc gcagagttta      1260
     accttcttag atgtttctga taataatatt tctggattat cggaattgcc accaaacttg      1320
     tattatctcg atgcatccag caatgaaata agatccttat gcgatttacc tccttcactg      1380
     gtagacctta atgtcaaaag taatcagttg agcgaactgc cagcgttacc tccacactta      1440
     gaacgtttaa tcgcttcatt taattatctt gctgaagtac ctgaattgcc gcaaaacctg      1500
     aaacagctcc acgtagagca aaacgctctg agagagtttc ccgatatacc tgagtcattg      1560
     gaagagcttg agatggactc tgaacgtgta gttgatccat atgaatttgc tcatgagact      1620
     acagacaaac ttgaagatga tgtttttgag tag                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page