(data stored in ACNUC9435 zone)

EMBL: BX936399.PE48

BX936399.PE48        Location/Qualifiers
FT   CDS_pept        complement(35009..35104)
FT                   /transl_table=11
FT                   /locus_tag="pYV0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25391"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L8"
FT                   /protein_id="CAF25391.1"
FT                   /translation="MAGIETTAPKYTDLKFNDIAGKVDSAAIQYF"
     atggccggta ttgaaactac tgccccaaaa tacactgatt taaagtttaa tgatattgcc        60
     ggtaaggttg actctgcggc catacaatac ttctga                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page