(data stored in ACNUC9435 zone)

EMBL: BX936399.PE49

BX936399.PE49        Location/Qualifiers
FT   CDS_pept        complement(35209..35424)
FT                   /transl_table=11
FT                   /locus_tag="pYV0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25392"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L7"
FT                   /protein_id="CAF25392.1"
FT                   /translation="MNSLSFHDNSIFCNKPKYSDAEVAQTLDTAQKHTLTVSKGVLDTA
FT                   KQYTNTVSSNTLDSANTYTNNKADSH"
     atgaatagcc tcagttttca tgacaactcc attttttgca acaagcccaa atatagtgat        60
     gctgaagtgg cacaaacgct ggataccgcg caaaagcaca ccctgacggt ttcaaaaggg       120
     gtactggata cggccaaaca gtatactaac accgtcagca gtaatacatt ggacagtgcc       180
     aatacctata ccaataataa agcagactca cattga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page