(data stored in ACNUC9435 zone)

EMBL: BX936399.PE51

BX936399.PE51        Location/Qualifiers
FT   CDS_pept        35593..35916
FT                   /transl_table=11
FT                   /locus_tag="pYV0051"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis Y0056, similar to Y. intermedia
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25394"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37133"
FT                   /protein_id="CAF25394.1"
FT                   /translation="MKRYQFTDADSSWQLDEIYIRVNGKWFYLYRAINKHGTTLDFYFS
FT                   PKRNKNTAYPFIKRVLKTYSVERQPKILNTDKHSSYGYAITRLMKEGKDTRCCKAAASQ
FT                   IPE"
     ttgaaacgat atcaatttac ggatgccgac tcctcatggc aactcgatga aatctatatc        60
     agggtcaacg gaaaatggtt ttatctctat cgcgccatca ataagcacgg cactacatta       120
     gatttttatt tttcgcctaa acgaaataaa aataccgcct atccattcat taaacgggtg       180
     ttaaaaacct attctgttga aagacagcct aaaatactca ataccgataa acattcgtca       240
     tacggttacg ctatcactcg tttgatgaaa gaaggaaaag atacgagatg ctgcaaagca       300
     gcggcaagtc aaatacctga ataa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page