(data stored in ACNUC9435 zone)

EMBL: BX936399.PE52

BX936399.PE52        Location/Qualifiers
FT   CDS_pept        35951..36073
FT                   /transl_table=11
FT                   /locus_tag="pYV0052"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-term Y. pestis YPCD1.24c, possible
FT                   transposase remnant"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25395"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L4"
FT                   /protein_id="CAF25395.1"
FT                   /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRRL"
     ttggtaaacg cggccgggga tttcaaacgg ccaaaccgtg cctggtcaac gcttcaggga        60
     tttgaaacat tgcgacgact gaataaaggt caatttgata tttggttacg ccggagactg       120
     taa                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page