(data stored in ACNUC9435 zone)

EMBL: BX936399.PE53

BX936399.PE53        Location/Qualifiers
FT   CDS_pept        36160..36327
FT                   /transl_table=11
FT                   /locus_tag="pYV0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25396"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L3"
FT                   /protein_id="CAF25396.1"
FT                   /translation="MSKITDSHYWDMCHSFLIAYYWNDTAFLTLSLYTSKMPITAADVL
FT                   NDRVLPFNNR"
     atgagtaaaa tcaccgactc tcattattgg gatatgtgtc attctttttt gattgcatat        60
     tactggaatg acacagcatt tctaacactc tcgctgtata cgagcaaaat gccgatcaca       120
     gccgctgacg tgctcaatga ccgcgtattg ccgttcaaca accggtaa                    168
//

If you have problems or comments...

PBIL Back to PBIL home page