(data stored in ACNUC9435 zone)

EMBL: BX936399.PE55

BX936399.PE55        Location/Qualifiers
FT   CDS_pept        complement(37490..38695)
FT                   /transl_table=11
FT                   /locus_tag="pYV0055"
FT                   /product="yopB; putative Yop targeting protein"
FT                   /note="similar to Y. pestis YPCD1.29c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25398"
FT                   /db_xref="GOA:Q06114"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06114"
FT                   /protein_id="CAF25398.1"
FT                   /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGV
FT                   SSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLASPD
FT                   TFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIA
FT                   SKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLISQEAM
FT                   KILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSAKVAQI
FT                   STGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQH
FT                   NNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPH
FT                   TV"
     atgagtgcgt tgataaccca tgaccgctca acgccagtaa ctggaagtct acttccctac        60
     gtcgagacac cagcgcccgc cccccttcag acccaacaag tcgcgggaga actgaaggat       120
     aaaaatggcg gggtgagttc tcagggcgta cagctccctg caccactagc agtggttgcc       180
     agccaagtta ctgaaggaca acagcaagaa gtcactaaat tattggagtc ggtcacccgc       240
     ggcgcggcag gatctcaact gatatcaaat tatgtttcag tgctaacgaa gtttacgctt       300
     gcttcacctg atacatttga gattgagtta ggtaagctag tttctaattt agaagaagta       360
     cgcaaagaca taaaaatcgc tgatattcag cgtcttcatg aacaaaacat gaagaaaatt       420
     gaagagaatc aagagaaaat caaagaaaca gaagagaatg ccaagcaagt caagaaatcc       480
     ggcattgcat caaagatttt tggctggctc agcgccatag cctcagtgat tgtcggtgcc       540
     atcatggtgg cctcaggggt aggagccgtt gccggtgcaa tgatggttgc ctcaggcgta       600
     attgggatgg cgaatatggc agtgaaacaa gcggcggaag atggcctgat atcccaagag       660
     gcaatgaaaa tattagggcc gatactcact gcgattgaag tcgcattgac tgtagtttca       720
     accgtaatga cctttggcgg ttcggcacta aaatgcctgg ctaatattgg cgcaaaactc       780
     ggtgctaaca ccgcaagtct tgcggctaaa ggagccgagt tttcggccaa agttgcccaa       840
     atttcgacag gcatatcaaa cactgtcggg agtgcagtga ctaaattagg gggcagtttt       900
     gctggtttaa caatgagcca tgcaatccgt acaggatcac aggcaacaca agtcgccgtt       960
     ggtgtgggca gcggaataac tcagaccatc aataataaaa agcaagctga tttacaacat      1020
     aataacgctg atttggcctt gaacaaggca gacatggcag cgttacaaag tattattgac      1080
     cgactcaaag aagaattatc ccatttgtca gagtcacatc aacaagtgat ggaactgatt      1140
     ttccagatga ttaatgcaaa aggtgacatg ctgcataatt tggccggcag accccatact      1200
     gtttaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page