(data stored in ACNUC9435 zone)

EMBL: BX936399.PE56

BX936399.PE56        Location/Qualifiers
FT   CDS_pept        complement(38673..39179)
FT                   /transl_table=11
FT                   /locus_tag="pYV0056"
FT                   /product="lcrH, sycD; low calcium response protein H"
FT                   /note="similar to Y. pestis YPCD1.30c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25399"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="PDB:1OOL"
FT                   /db_xref="PDB:1OOS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23995"
FT                   /protein_id="CAF25399.1"
FT                   /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAFN
FT                   QYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIKEP
FT                   RFPFHAAECLLQKGELAEAESGLFLAQELIADKPEFKELSTRVSSMLEAIKLKKEMEHE
FT                   CVDNP"
     atgcaacaag agacgacaga cactcaagaa taccagctgg caatggaatc cttcctaaaa        60
     ggagggggaa ctatcgccat gctcaacgaa atttcaagtg atactttaga gcaactctac       120
     tctcttgcat ttaaccaata ccagtcagga aaatacgagg atgctcacaa ggtctttcaa       180
     gctctctgtg tgctagacca ctatgattca cgtttctttt tagggctagg cgcttgtcgt       240
     caagccatgg ggcaatacga cttagcgatt catagctaca gctatggcgc cataatggat       300
     ataaaagaac ctcgttttcc gtttcatgcg gccgaatgtt tactgcaaaa gggagagctt       360
     gctgaagcag aaagtggctt gttcttggct caagagctta tcgcagacaa acctgagttt       420
     aaggagcttt ccacccgagt tagctcaatg ttagaagcaa ttaaattgaa aaaggagatg       480
     gaacatgagt gcgttgataa cccatga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page