(data stored in ACNUC9435 zone)

EMBL: BX936399.PE57

BX936399.PE57        Location/Qualifiers
FT   CDS_pept        complement(39192..40172)
FT                   /transl_table=11
FT                   /locus_tag="pYV0057"
FT                   /product="lcrV; putative V antigen, antihost
FT                   protein/regulator"
FT                   /note="similar to Y. pestis YPCD1.31c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25400"
FT                   /db_xref="GOA:P23994"
FT                   /db_xref="InterPro:IPR005413"
FT                   /db_xref="InterPro:IPR036139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23994"
FT                   /protein_id="CAF25400.1"
FT                   /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNID
FT                   ISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEF
FT                   LESSPNTQWELRAFMAVIHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAE
FT                   LKIYSVIQAEINKHLSSGGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEKMPQT
FT                   TIQEGETEKKIVSIKNFLESEKKRTGALGNLKDSYSYNKDNNELSHFATTCSDKSRPLN
FT                   DLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK"
     atgattagag cctacgaaca aaacccacaa cattttattg aggatctaga aaaagttagg        60
     gtggaacaac ttactggtca tggttcttca gttttagaag aattggttca gttagtcaaa       120
     gataaaaata tagatatttc cattaaatat gatcccagaa aagattcgga ggtttttgcc       180
     aatagagtaa ttactgatga tatcgaattg ctcaagaaaa tcctagctta ttttctaccc       240
     gaggatgcca ttcttaaagg cggtcattat gacaaccaac tgcaaaatgg catcaagcga       300
     gtaaaagagt tccttgaatc atcgccgaat acacaatggg aattgcgggc gttcatggca       360
     gtaatacatt tctctttaac cgccgatcgt atcgatgatg atattttgaa agtgattgtt       420
     gattcaatga atcatcatgg tgatgcccgt agcaagttgc gtgaagaatt agctgagctt       480
     accgccgaat taaagattta ttcagttatt caagccgaaa ttaataagca tctgtctagt       540
     ggtggcacca taaatatcca tgataaatca attaatctca tggataaaaa tttatatggt       600
     tatacagatg aagagatttt taaagccagt gcagagtaca aaattctcga gaaaatgcct       660
     caaaccacca ttcaggaagg tgagaccgaa aaaaaaatag tctcgataaa gaactttctt       720
     gaaagtgaga aaaaaagaac cggggcgttg ggtaatctga aagactcata ctcttataat       780
     aaagataata atgaattatc tcactttgcc accacctgct cggataagtc caggccgctc       840
     aacgacttgg ttagccaaaa aacaactcag ctgtctgata ttacatcacg ttttaattca       900
     gctattgaag cactgaaccg tttcattcag aaatatgatt cagtgatgca acgtctgcta       960
     gatgacacgt ctggtaaatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page