(data stored in ACNUC9435 zone)

EMBL: BX936399.PE6

BX936399.PE6         Location/Qualifiers
FT   CDS_pept        5803..5955
FT                   /transl_table=11
FT                   /locus_tag="pYV0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25349"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G1"
FT                   /protein_id="CAF25349.1"
FT                   /translation="MGPGNLLASPKMRKFIGVFAFLVPSKHLSRTSSLPPYGVASQKFF
FT                   KQSVI"
     gtgggccccg gtaaccttct cgcctcgcca aagatgagga agtttatcgg ggtttttgct        60
     tttctggttc caagtaaaca ccttagcaga accagttccc tgccacctta cggcgtggcc       120
     agccaaaaat tctttaaaca atcggtaatc tag                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page