(data stored in ACNUC9435 zone)

EMBL: BX936399.PE60

BX936399.PE60        Location/Qualifiers
FT   CDS_pept        complement(40940..43054)
FT                   /transl_table=11
FT                   /locus_tag="pYV0060"
FT                   /product="lcrD, yscV; putative membrane-bound Yop protein"
FT                   /note="similar to Y. pestis YPCD1.34c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25403"
FT                   /db_xref="GOA:P69956"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69956"
FT                   /protein_id="CAF25403.1"
FT                   /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILIA
FT                   VNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIVYT
FT                   FGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDGDMR
FT                   AGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIGVTQK
FT                   GLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGKQVVAQ
FT                   PKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDLQSILTS
FT                   GSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALNDELVRVRR
FT                   ALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVPVARGELKAGYLLVRESVSQLELLGI
FT                   PYEKGEHLLPDQEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREYAEDFIGIQE
FT                   TRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQKE
FT                   KDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALEP
FT                   AVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQI
FT                   NIQPLGRICL"
     atgaatcccc atgatcttga gtggctaaat cgtattggcg agcgtaaaga tatcatgctg        60
     gcagtgctgc tgttagctgt ggtattcatg atggtcttac cactcccccc ccttgtgttg       120
     gacattctga ttgctgttaa catgaccatt tcagtggtgt tgttaatgat agcgatctat       180
     atcaactctc ctttacaatt ttcagctttc cctgcggtgc tactcgttac cacgttattt       240
     cgtctcgcac tttcagttag caccacccgc atgatcctgc tacaagctga tgcggggcag       300
     attgtttaca cctttggtaa tttcgtcgtt ggcggtaacc tcatcgtcgg gattgtcatc       360
     ttcctgatca tcactattgt gcaattttta gtgataacga aaggctcaga acgtgtagca       420
     gaagttagtg ccagattctc tcttgatgcg atgccgggta aacagatgag tatcgatggc       480
     gatatgcgag ccggggtgat cgatgtcaat gaagcgcgtg agcggcgcgc gacgatagaa       540
     aaagaaagcc aaatgttcgg ttctatggac ggcgccatga agttcgtcaa aggggatgca       600
     atagccggcc tcattattat ctttgtcaat atattaggcg gcgtcaccat tggtgttacc       660
     caaaaaggat tagcggccgc tgaggcactg caactctatt ccatcctcac tgtcggggat       720
     gggatggttt ctcaggtacc tgccctgctg atagctatta ccgcgggtat tatcgtcacc       780
     cgcgtctctt cagaagattc atcagacctg ggtagcgata ttggcaaaca ggttgtcgct       840
     cagcctaaag ccatgctaat tggtggcgta ctgctgttgc tctttggtct tatccccggc       900
     ttcccaacag tcacctttct gattttggcg ctattggtag gctgtggtgg ttatatgctc       960
     agccgtaagc agagtcgtaa tgacgaggct aatcaagacc tgcaatccat actgacgagc      1020
     ggttctggcg ccccggctgc tcgaaccaaa gccaaaacaa gtggggcaaa caagggccga      1080
     ctaggggaac aagaagcatt tgctatgacg gttcccttgc tgattgatgt agattcaagc      1140
     caacaggaag cactggaagc gatagcacta aatgatgagc tggttcgagt gcgccgtgct      1200
     ctttatcttg atcttggcgt acctttccct gggatccatc tgcgttttaa tgaggggatg      1260
     ggtgaaggcg aatatattat ttccttgcaa gaagttccag tggcgcgagg tgagcttaag      1320
     gcaggttatt tactcgtgcg tgaatccgtc agccaactcg aattactggg tataccctat      1380
     gaaaaagggg aacatttgct acccgatcag gaagctttct gggtatcggt tgaatatgag      1440
     gagcgcctgg aaaagtctca actggaattt ttctctcatt cccaagttct aacctggcat      1500
     ctttctcatg tcctacgtga atatgccgaa gatttcattg gtatccaaga aacccgctat      1560
     ctgctcgaac agatggaagg aggctatggc gaattaatta aagaagtaca aagaatcgtt      1620
     cccttacaac gaatgaccga aatattacaa cgattagttg gagaagatat ttctatccgt      1680
     aatatgcgat ctattcttga agctatggtg gaatggggac aaaaagagaa agacgtcgtt      1740
     caactcacag aatatatccg cagtagtcta aaacgttata tctgctacaa atacgctaat      1800
     ggcaacaata tattgccggc ttatcttttc gatcaagaag tagaagaaaa aattcgtagc      1860
     ggtgtgcgcc aaaccagtgc agggagttat ttggcattgg agcctgctgt taccgagagt      1920
     ttacttgaac aagttcgcaa gactattggc gatctatcgc aaatccagag taaaccggtg      1980
     ctgattgttt ctatggatat tcgtcgctat gtgcgcaaac tgattgagag tgaatactat      2040
     ggcttgccgg tactttcata ccaagagctg actcagcaga ttaatatcca accacttgga      2100
     cgaatttgct tatga                                                       2115
//

If you have problems or comments...

PBIL Back to PBIL home page