(data stored in ACNUC9435 zone)

EMBL: BX936399.PE64

BX936399.PE64        Location/Qualifiers
FT   CDS_pept        complement(44105..44383)
FT                   /transl_table=11
FT                   /locus_tag="pYV0064"
FT                   /product="tyeA; putative Yop secretion and targeting
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.38c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25407"
FT                   /db_xref="InterPro:IPR013351"
FT                   /db_xref="InterPro:IPR015144"
FT                   /db_xref="InterPro:IPR038347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69969"
FT                   /protein_id="CAF25407.1"
FT                   /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRFY
FT                   QDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
     atggcgtacg acctttctga gtttatggga gatattgtcg cactggttga caagcgctgg        60
     gcggggattc atgacattga acatcttgcc aacgcctttt cccttcctac gcctgaaatc       120
     aaagtgcgtt tctatcaaga tttaaaaaga atgtttcgtc ttttccctct gggggtattt       180
     agcgatgagg agcaacggca aaatttattg caaatgtgtc aaaatgcgat cgatatggct       240
     attgagagtg aagaggaaga attgagtgag ttggattga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page