(data stored in ACNUC9435 zone)

EMBL: BX936399.PE65

BX936399.PE65        Location/Qualifiers
FT   CDS_pept        complement(44364..45245)
FT                   /transl_table=11
FT                   /locus_tag="pYV0065"
FT                   /product="yopN, lcrE; putative membrane-bound Yop targeting
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.39c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25408"
FT                   /db_xref="GOA:Q663K1"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663K1"
FT                   /protein_id="CAF25408.1"
FT                   /translation="MTTLHNLSYGNTPLHNERPEIASSQIVNQTLGQFRGESVQIVSGT
FT                   LQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQNVS
FT                   ELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVEQAL
FT                   VSMAEEQGETIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSDLQKR
FT                   FPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVINDLQKLKEFGSVSDQVKGFWQF
FT                   FSEGKTNGVRPF"
     atgacgacgc ttcataacct atcttatggc aataccccgc tgcataatga gcgtccagag        60
     attgccagta gtcagatcgt aaatcagact ctgggtcaat ttcggggaga atctgtgcag       120
     atagtcagcg gcactctgca gtctatagct gatatggcag aagaggtaac atttgtcttc       180
     tccgagcgta aggagctctc cctcgacaaa cgcaaattaa gtgacagcca ggctcgagtt       240
     agcgacgttg aggagcaggt taatcaatac cttagcaaag ttccagagtt ggaacaaaaa       300
     cagaatgtga gtgagctgct cagtctgttg agtaacagcc ccaatataag cttgtcccag       360
     ttaaaggctt atctggaggg gaaatcagaa gaaccgagtg agcaattcaa aatgctctgc       420
     ggcttgcgtg atgccctgaa agggcgccct gaattagcac atctttcgca tttggttgaa       480
     caagctctgg tcagcatggc tgaagagcaa ggagaaacca ttgtattggg tgccaggata       540
     accccggaag cgtacagaga atcccagtcg ggtgttaatc cactgcagcc gctccgtgat       600
     acctaccgcg atgcagtgat gggttatcaa ggaatttatg cgatctggag tgatttacaa       660
     aaacgttttc ctaatgggga tatagactcg gtgatattat tcctgcaaaa ggcgcttagt       720
     gcagatctac aaagtcaaca aagcgggtct ggacgggaaa aattaggaat agttattaat       780
     gacttacaga agctaaagga gtttggtagc gtgagtgacc aagttaaagg attttggcaa       840
     tttttttcag agggtaaaac taatggcgta cgacctttct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page