(data stored in ACNUC9435 zone)

EMBL: BX936399.PE66

BX936399.PE66        Location/Qualifiers
FT   CDS_pept        45305..45409
FT                   /transl_table=11
FT                   /locus_tag="pYV0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25409"
FT                   /db_xref="UniProtKB/TrEMBL:Q663K0"
FT                   /protein_id="CAF25409.1"
FT                   /translation="MLIDAKISREILVLLGYFSKNSRLPLQFFSVFSH"
     ttgcttatcg atgccaaaat cagccgagaa attttagtgc tgcttggcta tttttctaaa        60
     aactcgcggc tcccgctaca attttttagc gtttttagtc actaa                       105
//

If you have problems or comments...

PBIL Back to PBIL home page