(data stored in ACNUC9435 zone)

EMBL: BX936399.PE68

BX936399.PE68        Location/Qualifiers
FT   CDS_pept        46759..47223
FT                   /transl_table=11
FT                   /locus_tag="pYV0068"
FT                   /product="yscO; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.41"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25411"
FT                   /db_xref="GOA:P40294"
FT                   /db_xref="InterPro:IPR009929"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40294"
FT                   /protein_id="CAF25411.1"
FT                   /translation="MIRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDYH
FT                   LWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERERL
FT                   TLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
     atgatacgcc gcctgcaccg ggttaaagtt ttacgcgttg aacgtgcgga gaaagccatc        60
     aagactcagc aagcttgctt gcaggcagct catcgacgtc atcaagaggc ggtgcaaacc       120
     agtcaggatt accatttgtg gcgtattgat gaggagcaac gtctatttga tcagcgaaaa       180
     aacaccacac tgaattgtaa agatttggag aaatggcagc gacaaatagc gtcgctacgt       240
     gaaaaggagg ccaattatga actggagtgc gccaaattat tggaacgttt agccaatgag       300
     cgtgagcgcc ttacgttatg ccaaaagatg ctgcaacagg ctcgtcataa ggaaaataag       360
     tttctcgagc tagtgcgacg agaagatgaa gatgagttaa atcaacaaca ttatcaggaa       420
     gaacaagaac aagaagagtt tctacagcat cacaggaacg cctaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page