(data stored in ACNUC9435 zone)

EMBL: BX936399.PE69

BX936399.PE69        Location/Qualifiers
FT   CDS_pept        47223..48590
FT                   /transl_table=11
FT                   /locus_tag="pYV0069"
FT                   /product="yscP; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.42"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25412"
FT                   /db_xref="GOA:Q663J7"
FT                   /db_xref="InterPro:IPR013354"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663J7"
FT                   /protein_id="CAF25412.2"
FT                   /translation="MNKITTRSPLEPEYQPLGKPHHALQACVDFEQALLHNNKGNCHPK
FT                   EESLKPVRPHDLGKKEGQKGDGLRAHAPLAATSQPGRKEVGLKPQHNHQNNHDFNLSPL
FT                   AEGATNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHDELF
FT                   VQQSPIDSAQPVQLNTKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQKRLAE
FT                   EPLALHQKALPEICPPAVSATPDDHLVARWCATPVTEVAEKSARFPYKATVQSEQLDMT
FT                   ELADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVVTPGDHLLATM
FT                   RATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEIPGKLHVE
FT                   LIASREALRILAQGSYDLLERLQRIEPTQLDFQASDDSEQESRQKRHVYEEWEAEE"
     atgaataaaa tcaccactcg ttccccatta gaacctgagt atcaacctct ggggaagccg        60
     catcatgctt tgcaagcatg tgtcgatttt gagcaagcgc tgttgcataa taataagggg       120
     aattgtcatc ccaaagaaga gtcgcttaaa cctgtacgtc cgcatgacct tggcaaaaaa       180
     gaaggtcaga aaggagatgg cttgcgtgcg catgcgccat tagcggcgac gtctcaaccc       240
     ggaaggaaag aggtaggatt aaaacctcaa cacaaccatc agaataatca tgatttcaac       300
     ttatctccgc ttgccgaagg tgctaccaat agagcgcact tataccagca ggatagccgt       360
     tttgatgacc gcgtagagag tattattaat gctctcatgc cattggcgcc ctttttagag       420
     ggggtgactt gtgaaacggg gacatcaagt gaatccccct gcgagccgtc tggacatgat       480
     gagttatttg ttcagcaatc gcctatcgat tccgctcaac cagttcaatt gaataccaag       540
     ccgactgttc agccattgaa tccggctgct gacggcgcag aggttattgt atggtctgtc       600
     ggtagggaaa ctccggccag tatagcaaaa aaccagcgcg atagcaggca aaaacgcctt       660
     gcagaagaac cgttagctct tcatcaaaaa gcattgccag agatatgtcc cccggcagtt       720
     agtgccacac cggatgatca tttggtagca agatggtgtg ctactcctgt gactgaggta       780
     gcagaaaaat ctgctcgttt tccgtacaaa gcgacagtgc agtcagagca actggacatg       840
     accgagctgg cggatcggtc ccaacatctt actgatggcg ttgatagcag caaagatacc       900
     atcgaaccac cgcgaccaga agaactgtta cttccgcgcg aagaaacctt gccggagatg       960
     tattccttgt cttttacagc accggttgtc acgccgggtg atcacctatt agcaacaatg      1020
     cgcgcgacca ggctggcatc agtctcagag caacttatac agttagcaca gcgactagcg      1080
     gtagaactag aactgcgcgg cggctcatcc caagtaaccc aattacacct taacttacct      1140
     gaattggggg ctattatggt tcgtattgct gagattccgg gaaaactgca tgtagaactg      1200
     atcgccagtc gggaagcttt aagaatttta gcgcagggaa gttatgatct tcttgagcga      1260
     ttacaacgca ttgagccaac acaacttgat tttcaagcta gcgatgacag tgaacaggag      1320
     tcacgtcaga aacgccacgt ctatgaggag tgggaggctg aagaatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page