(data stored in ACNUC9435 zone)

EMBL: BX936399.PE70

BX936399.PE70        Location/Qualifiers
FT   CDS_pept        48587..49510
FT                   /transl_table=11
FT                   /locus_tag="pYV0070"
FT                   /product="yscQ; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.43"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25413"
FT                   /db_xref="GOA:P40296"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="PDB:3UEP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40296"
FT                   /protein_id="CAF25413.1"
FT                   /translation="MSLLTLPQAKLSELSLRQRLSHYQQNYLWEEGKLELTVSEPPSSL
FT                   NCILQLQWKGTHFTLYCFGNDLANWLTADLLGAPFFTLPKELQLALLERQTVFLPKLVC
FT                   NDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILISLRW
FT                   HKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHES
FT                   DELNPEPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRL
FT                   LGHGRLVEIQGRLGVRIERLTEVTIS"
     atgagtttgt taaccttgcc acaggccaaa ttaagtgaac tgtcgctacg tcaacggctc        60
     agccattatc aacaaaacta cttgtgggaa gagggaaaac tcgaacttac cgtctctgag       120
     cctccttcgt ctttgaactg tatattacag ttacaatgga agggaacgca cttcacgctc       180
     tactgttttg gcaatgatct ggctaactgg ttaaccgccg acttactagg ggctccattc       240
     tttactctgc cgaaagagtt gcaacttgcg ctgttggaac gccagacagt tttcctgccg       300
     aaactggtct gtaatgatat agcgacagcg tctctttctg tcacgcaacc tctgttgagt       360
     ttgcggctgt cccgagataa tgcgcatatc tccttctggc taacctcagc tgaggctctg       420
     ttcgctctgt tacccgcacg acccaattct gagcgcatac ctttgcctat ccttatttct       480
     ttgcgttggc ataaagtata cctgactcta gatgaggttg attcccttcg attaggtgat       540
     gtgttgttgg cccctgaggg gagtgggcct aattcgccag tactcgccta tgttggtgag       600
     aacccttggg gctactttca attacaatca aataaattgg agtttatcgg tatgagtcat       660
     gaatctgacg aacttaaccc cgaaccattg accgatttga accaacttcc ggttcaagtt       720
     agctttgaag tggggcggca aatcttagat tggcacacac tcactagcct ggagccgggt       780
     tctcttattg atcttacaac acctgttgat ggtgaagtgc gcttgctggc taacggccgg       840
     ttgcttggac atggtcgatt ggtcgagatc caagggcgcc tcggggttcg aattgaacgc       900
     ctgacagagg ttacgatttc atga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page